BLASTX nr result
ID: Rehmannia27_contig00056822
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00056822 (806 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI17934.1| hypothetical protein [uncultured Desulfobacterale... 64 4e-10 >gb|ADI17934.1| hypothetical protein [uncultured Desulfobacterales bacterium HF0200_07G10] Length = 74 Score = 64.3 bits (155), Expect = 4e-10 Identities = 35/69 (50%), Positives = 41/69 (59%) Frame = -2 Query: 604 GTL*HALTGTELYHRWAFWNGHCLNSFRRKQAITKFV*PFTPIHNSSKVFTTNTGSALHE 425 G L L E Y F+ L FR + AI F PFTPIHNSSK+F+T+TGS LHE Sbjct: 5 GNLVRPLAHPEPYLHMLFYARLVLKLFRGEPAIAGFDWPFTPIHNSSKLFSTSTGSGLHE 64 Query: 424 LLLSFQPGH 398 +L S PGH Sbjct: 65 VLPSLHPGH 73