BLASTX nr result
ID: Rehmannia27_contig00055842
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00055842 (459 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850073.1| PREDICTED: uncharacterized protein LOC105969... 64 5e-09 >ref|XP_012850073.1| PREDICTED: uncharacterized protein LOC105969842 [Erythranthe guttata] Length = 760 Score = 63.5 bits (153), Expect = 5e-09 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +3 Query: 204 PKFQVIAPKLHR*TIPTSYWSLTFFVG*LDGGLRFPMHSFFAEVSTMYNIPLNQFTPNSF 383 P F ++ P ++ LT+++ GL FP+H FF +VS +Y +PL+ F PN+ Sbjct: 74 PSFHLVVPSRNQTPSNPPPGYLTWYLDQFKAGLSFPLHPFFVDVSRVYRVPLHLFHPNAI 133 Query: 384 KIISGFLIITKFLSIDPSPDL-FSLF 458 K +S F I+ +DP P+L FSLF Sbjct: 134 KFMSCFYIVCVGTGVDPRPELFFSLF 159