BLASTX nr result
ID: Rehmannia27_contig00055643
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00055643 (422 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828445.1| PREDICTED: terpene synthase 10-like [Erythra... 59 2e-07 ref|XP_012828395.1| PREDICTED: (-)-alpha-terpineol synthase-like... 56 2e-06 ref|XP_012828394.1| PREDICTED: terpene synthase 10-like isoform ... 56 2e-06 gb|AHI50308.2| limonene-myrcene synthase [Erythranthe lewisii] g... 54 8e-06 >ref|XP_012828445.1| PREDICTED: terpene synthase 10-like [Erythranthe guttata] Length = 632 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Frame = +3 Query: 288 RRCSLQCKA--TNSDQLIIIP-TTRRSGHYKPPIWDFDFVQSLNNEYK 422 R CSLQC A N DQ ++ RRSG+Y+PP+W FDFVQSLN +YK Sbjct: 50 RPCSLQCNAQVNNCDQARLVTIVNRRSGNYEPPVWSFDFVQSLNTKYK 97 >ref|XP_012828395.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Erythranthe guttata] Length = 515 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 2/90 (2%) Frame = +3 Query: 159 MAIPNKPITKNNFIIDRKPNWKKVYYVNVCCINGSADPTGLRRRRCS-LQCKATN-SDQL 332 +AI NKP+ + RK K ++V P+ + + CS L+C A D L Sbjct: 8 LAISNKPVDCISSFSTRKH--LKAWFV----------PSLVIKPNCSSLKCNAKAVCDDL 55 Query: 333 IIIPTTRRSGHYKPPIWDFDFVQSLNNEYK 422 +I PT RR+G+YKP +W FD++QSLN++YK Sbjct: 56 VINPTVRRTGNYKPSLWGFDYLQSLNSKYK 85 >ref|XP_012828394.1| PREDICTED: terpene synthase 10-like isoform X1 [Erythranthe guttata] gi|604298373|gb|EYU18417.1| hypothetical protein MIMGU_mgv1a003023mg [Erythranthe guttata] Length = 614 Score = 55.8 bits (133), Expect = 2e-06 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 2/90 (2%) Frame = +3 Query: 159 MAIPNKPITKNNFIIDRKPNWKKVYYVNVCCINGSADPTGLRRRRCS-LQCKATN-SDQL 332 +AI NKP+ + RK K ++V P+ + + CS L+C A D L Sbjct: 8 LAISNKPVDCISSFSTRKH--LKAWFV----------PSLVIKPNCSSLKCNAKAVCDDL 55 Query: 333 IIIPTTRRSGHYKPPIWDFDFVQSLNNEYK 422 +I PT RR+G+YKP +W FD++QSLN++YK Sbjct: 56 VINPTVRRTGNYKPSLWGFDYLQSLNSKYK 85 >gb|AHI50308.2| limonene-myrcene synthase [Erythranthe lewisii] gi|692117515|gb|AHI50309.2| limonene-myrcene synthase [Erythranthe lewisii] Length = 615 Score = 53.9 bits (128), Expect = 8e-06 Identities = 36/86 (41%), Positives = 47/86 (54%), Gaps = 2/86 (2%) Frame = +3 Query: 159 MAIPNKPITKNNFIIDRKPNWKKVYYVNVCCINGSADPTGLRRRRC-SLQCKATNSDQLI 335 +AIPNKPI + +K + Y+ GL+ C S+QC A DQ Sbjct: 9 LAIPNKPIKS---LSSKKSKFCFASYI--------PSANGLKIEPCASIQCNAQVCDQS- 56 Query: 336 IIPTT-RRSGHYKPPIWDFDFVQSLN 410 PT RRSG+Y+PP+WDFDFVQSL+ Sbjct: 57 --PTVDRRSGNYEPPLWDFDFVQSLS 80