BLASTX nr result
ID: Rehmannia27_contig00055455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00055455 (644 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACA34975.1| phantastica [Corytoplectus speciosus] 56 7e-06 >gb|ACA34975.1| phantastica [Corytoplectus speciosus] Length = 358 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/61 (47%), Positives = 39/61 (63%), Gaps = 5/61 (8%) Frame = +1 Query: 415 GRYFR--KPLHKRSIK*RTSPVITMATSYGGYIQNDQTAPPTPSLLPPWLASS---TTIR 579 G+Y R + ++ +K RT+P I MATS GG++ D AP PS+LPPWL S TT+R Sbjct: 124 GKYDRILETFAEKLVKERTAPGIAMATSNGGFLHTDPPAPSAPSVLPPWLVGSSMATTVR 183 Query: 580 P 582 P Sbjct: 184 P 184