BLASTX nr result
ID: Rehmannia27_contig00055149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00055149 (655 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515222.1| PREDICTED: protein NIM1-INTERACTING 1 [Ricin... 53 1e-05 >ref|XP_002515222.1| PREDICTED: protein NIM1-INTERACTING 1 [Ricinus communis] gi|223545702|gb|EEF47206.1| hypothetical protein RCOM_1345340 [Ricinus communis] Length = 115 Score = 52.8 bits (125), Expect = 1e-05 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 7/76 (9%) Frame = -2 Query: 468 FFAFMRKTR-------NQLHQLQEKSNKRKRTTTSATGWVPVFQWEDFTTEIVFKKHVPK 310 FFA +R+ R +++ + +++ NK +R WVP F+WEDFT EI F+ P Sbjct: 29 FFALIRRFREARNRRKDEVQEEEKRKNKIRRLNEEHPSWVPSFEWEDFTEEIQFRSRPPV 88 Query: 309 IPNPRNNNGKQELVEP 262 I PR N KQE +P Sbjct: 89 I-FPRPCNQKQEKKQP 103