BLASTX nr result
ID: Rehmannia27_contig00055076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00055076 (436 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086479.1| PREDICTED: UPF0481 protein At3g47200-like is... 60 4e-08 >ref|XP_011086479.1| PREDICTED: UPF0481 protein At3g47200-like isoform X1 [Sesamum indicum] Length = 423 Score = 60.5 bits (145), Expect = 4e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 5 YTGIVDRVNKHYKQPWNRAMAVLRRDYFSSPWAY 106 Y I DRVN HYK+ WNRAMA+LRRDYF+SPW+Y Sbjct: 364 YGTICDRVNTHYKKRWNRAMALLRRDYFNSPWSY 397