BLASTX nr result
ID: Rehmannia27_contig00053490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00053490 (387 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102115.1| PREDICTED: tetratricopeptide repeat protein ... 61 8e-09 >ref|XP_011102115.1| PREDICTED: tetratricopeptide repeat protein 33 [Sesamum indicum] Length = 214 Score = 60.8 bits (146), Expect = 8e-09 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = +3 Query: 168 KMTRQKNLSDSISKTKKQNISLNPNLPFEAHVSSSDSNSETEPLKEGKLLEHDDVGK 338 KMT +KN DS +KT+K+ IS NPNLPFE SSSD+N+ +KEG+ +DDV K Sbjct: 2 KMTWKKNAGDSKNKTRKRPISFNPNLPFEDLNSSSDTNTTAAKMKEGESRGNDDVSK 58