BLASTX nr result
ID: Rehmannia27_contig00053396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00053396 (449 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKZ21633.1| ATP synthase CF0 B subunit (plastid) [Solanum tri... 62 2e-09 gb|AAA84683.1| ATPase subunit I (chloroplast) [Nicotiana tabacum... 62 3e-09 gb|AFU96498.1| AtpF, partial (chloroplast) [Ixonanthes sp. CCD-2... 62 3e-09 gb|AJS14324.1| ATP synthase CF0 subunit I (chloroplast) [Iochrom... 61 4e-09 gb|AGJ51243.1| ATP synthase CF0 B subunit (chloroplast) [Solanum... 61 4e-09 sp|P06290.3|ATPF_TOBAC RecName: Full=ATP synthase subunit b, chl... 62 5e-09 ref|YP_358658.1| ATP synthase CF0 B subunit [Nicotiana sylvestri... 62 5e-09 prf||1211235F ATPase I 62 5e-09 gb|AMK95888.1| ATP synthase CF0 subunit I (chloroplast) [Saltugi... 61 6e-09 ref|YP_009121601.1| ATP synthase CF0 subunit I (chloroplast) [Sa... 61 6e-09 ref|YP_009123143.1| ATP synthase CF0 subunit I (chloroplast) [Du... 61 6e-09 gb|AGL45322.1| AtpF (chloroplast) [Sesamum indicum] 61 6e-09 gb|AMC30732.1| ATP synthase CF0 B subunit (chloroplast) [Euphorb... 61 6e-09 gb|AMC30731.1| ATP synthase CF0 B subunit (chloroplast) [Euphorb... 61 6e-09 gb|ABB90029.1| ATP synthase CF0 B chain [Solanum tuberosum] 61 6e-09 ref|YP_009183578.1| ATP systhase CF0 B subunit (chloroplast) [Sc... 61 6e-09 gb|AKZ21637.1| ATP synthase CF0 B subunit (plastid) [Teucrium ca... 61 6e-09 gb|AKZ21630.1| ATP synthase CF0 B subunit (plastid) [Physalis vi... 61 6e-09 gb|AKZ21628.1| ATP synthase CF0 B subunit (plastid) [Ellisia nyc... 61 6e-09 ref|YP_398845.1| ATP synthase CF0 B subunit [Nicotiana tomentosi... 61 6e-09 >gb|AKZ21633.1| ATP synthase CF0 B subunit (plastid) [Solanum triflorum] Length = 184 Score = 62.4 bits (150), Expect = 2e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 337 THLFRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 T FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 92 TEQFRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >gb|AAA84683.1| ATPase subunit I (chloroplast) [Nicotiana tabacum] gi|224351|prf||1102209E ORF 5 Length = 162 Score = 61.6 bits (148), Expect = 3e-09 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +1 Query: 331 STTHLFRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 S FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 68 SEAEQFRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 106 >gb|AFU96498.1| AtpF, partial (chloroplast) [Ixonanthes sp. CCD-2012] Length = 186 Score = 62.0 bits (149), Expect = 3e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FR NGYS I+RENLNLINSTY TLEQLENYKNET Sbjct: 95 FRANGYSEIERENLNLINSTYKTLEQLENYKNET 128 >gb|AJS14324.1| ATP synthase CF0 subunit I (chloroplast) [Iochroma calycinum] Length = 158 Score = 61.2 bits (147), Expect = 4e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 69 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 102 >gb|AGJ51243.1| ATP synthase CF0 B subunit (chloroplast) [Solanum carolinense] Length = 162 Score = 61.2 bits (147), Expect = 4e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 73 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 106 >sp|P06290.3|ATPF_TOBAC RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I (chloroplast) [Nicotiana tabacum] Length = 184 Score = 61.6 bits (148), Expect = 5e-09 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +1 Query: 331 STTHLFRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 S FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 90 SEAEQFRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >ref|YP_358658.1| ATP synthase CF0 B subunit [Nicotiana sylvestris] gi|81238325|ref|NP_054482.2| ATP synthase CF0 B subunit [Nicotiana tabacum] gi|351653861|ref|YP_004891586.1| atpF gene product (chloroplast) [Nicotiana undulata] gi|122213542|sp|Q3C1H3.1|ATPF_NICSY RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I (chloroplast) [Nicotiana sylvestris] gi|76559638|emb|CAA77342.2| ATPase I subunit [Nicotiana tabacum] gi|77799544|dbj|BAE46633.1| ATPase I subunit [Nicotiana sylvestris] gi|347453887|gb|AEO95545.1| ATP synthase CF0 subunit I (chloroplast) [Nicotiana undulata] gi|347453998|gb|AEO95655.1| ATP synthase CF0 subunit I [synthetic construct] gi|1001824177|gb|AMM05529.1| ATP synthase CF0 B subunit (plastid) [Nicotiana tabacum] Length = 184 Score = 61.6 bits (148), Expect = 5e-09 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +1 Query: 331 STTHLFRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 S FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 90 SEAEQFRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >prf||1211235F ATPase I Length = 184 Score = 61.6 bits (148), Expect = 5e-09 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +1 Query: 331 STTHLFRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 S FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 90 SEAEQFRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >gb|AMK95888.1| ATP synthase CF0 subunit I (chloroplast) [Saltugilia splendens subsp. grantii] Length = 177 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 88 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 121 >ref|YP_009121601.1| ATP synthase CF0 subunit I (chloroplast) [Salix suchowensis] gi|772657735|ref|YP_009128775.1| ATP synthase CF0 subunit I (chloroplast) [Salix purpurea] gi|751371660|gb|AJF48560.1| ATP synthase CF0 subunit I (chloroplast) [Salix suchowensis] gi|765099759|gb|AJR28262.1| ATP synthase CF0 subunit I (chloroplast) [Salix purpurea] Length = 180 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 95 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >ref|YP_009123143.1| ATP synthase CF0 subunit I (chloroplast) [Dunalia obovata] gi|756419256|gb|AJL34395.1| ATP synthase CF0 subunit I (chloroplast) [Dunalia obovata] Length = 183 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 94 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 127 >gb|AGL45322.1| AtpF (chloroplast) [Sesamum indicum] Length = 183 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 94 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 127 >gb|AMC30732.1| ATP synthase CF0 B subunit (chloroplast) [Euphorbia marginata] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 343 LFRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 LFR NGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 94 LFRTNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >gb|AMC30731.1| ATP synthase CF0 B subunit (chloroplast) [Euphorbia esula] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +1 Query: 343 LFRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 LFR NGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 94 LFRTNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >gb|ABB90029.1| ATP synthase CF0 B chain [Solanum tuberosum] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 95 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >ref|YP_009183578.1| ATP systhase CF0 B subunit (chloroplast) [Scutellaria insignis] gi|949600138|gb|ALN11589.1| ATP systhase CF0 B subunit (chloroplast) [Scutellaria insignis] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 95 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >gb|AKZ21637.1| ATP synthase CF0 B subunit (plastid) [Teucrium canadense] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 95 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >gb|AKZ21630.1| ATP synthase CF0 B subunit (plastid) [Physalis virginiana] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 95 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >gb|AKZ21628.1| ATP synthase CF0 B subunit (plastid) [Ellisia nyctelea] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 95 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128 >ref|YP_398845.1| ATP synthase CF0 B subunit [Nicotiana tomentosiformis] gi|122212916|sp|Q33C52.1|ATPF_NICTO RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I (chloroplast) [Nicotiana tomentosiformis] gi|80750907|dbj|BAE47983.1| ATPase I subunit [Nicotiana tomentosiformis] Length = 184 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 346 FRVNGYS*IKRENLNLINSTY*TLEQLENYKNET 447 FRVNGYS I+RE LNLINSTY TLEQLENYKNET Sbjct: 95 FRVNGYSEIEREKLNLINSTYKTLEQLENYKNET 128