BLASTX nr result
ID: Rehmannia27_contig00053156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00053156 (519 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835260.1| PREDICTED: trihelix transcription factor ASI... 52 4e-08 ref|XP_012833535.1| PREDICTED: trihelix transcription factor ASI... 54 8e-08 >ref|XP_012835260.1| PREDICTED: trihelix transcription factor ASIL2-like [Erythranthe guttata] gi|604335287|gb|EYU39229.1| hypothetical protein MIMGU_mgv11b007723mg [Erythranthe guttata] Length = 345 Score = 52.4 bits (124), Expect(2) = 4e-08 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -1 Query: 333 KKGQLKAFQWEKISXXXXXXVAACCGFDEPSRLQTSTQCRQKQEK 199 KKGQLKAFQWE++S VAA CG DEPS+ T+TQCR K EK Sbjct: 74 KKGQLKAFQWEEVS----VTVAARCGLDEPSK--TATQCRHKIEK 112 Score = 32.0 bits (71), Expect(2) = 4e-08 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 7/66 (10%) Frame = -2 Query: 518 FKSPQTPSPSPHNRNLRRHP-------HPNHTLLHQARSPISTSTRIQTCLPSQIQETLA 360 + SP T SPSP ++HP P+ + H P +T ++ +P +ETLA Sbjct: 3 YSSPST-SPSPPPPPQQQHPPSRSHSCSPSLSPKHVPPHPPATESKKSPPVPWSDEETLA 61 Query: 359 LIQAYQ 342 +I+AYQ Sbjct: 62 IIKAYQ 67 >ref|XP_012833535.1| PREDICTED: trihelix transcription factor ASIL1-like [Erythranthe guttata] Length = 332 Score = 54.3 bits (129), Expect(2) = 8e-08 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 333 KKGQLKAFQWEKISXXXXXXVAACCGFDEPSRLQTSTQCRQKQEK 199 KKGQLK+FQWE++S VAA CGFDEP+R TSTQCR K EK Sbjct: 61 KKGQLKSFQWEELS----VTVAARCGFDEPTR--TSTQCRHKIEK 99 Score = 28.9 bits (63), Expect(2) = 8e-08 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -2 Query: 512 SPQTPSPSPHNRNLRRHPHPNHTLLHQARSPISTST-RIQTCLPSQIQETLALIQAYQ 342 SP + P P + L +P T S STST + P ETLALIQAYQ Sbjct: 3 SPPSSPPPPQSYPLSPNPESIPT------SSKSTSTPKKSAAFPWSHDETLALIQAYQ 54