BLASTX nr result
ID: Rehmannia27_contig00053085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00053085 (706 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093909.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 62 1e-07 ref|XP_012851138.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 57 3e-07 gb|EYU25788.1| hypothetical protein MIMGU_mgv1a027166mg, partial... 57 5e-06 >ref|XP_011093909.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Sesamum indicum] Length = 493 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 584 FKYFFTIFLFSMIIGGQLYVDGLGCNWGLQATHPLSPDIVV 706 + Y FTIFLF M+ G L VDGLGCNWG QA+HPL PDI+V Sbjct: 4 YHYLFTIFLFFML-GQHLLVDGLGCNWGTQASHPLPPDIIV 43 >ref|XP_012851138.1| PREDICTED: glucan endo-1,3-beta-glucosidase 5-like [Erythranthe guttata] Length = 115 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +2 Query: 587 KYFFTIFLFSMII-GGQLYVDGLGCNWGLQATHPLSPDIVV 706 KY F + L ++ + G +L+ DGLGCNWG QATHPL PDIVV Sbjct: 5 KYLFVLVLTNVFLFGDRLFADGLGCNWGTQATHPLRPDIVV 45 >gb|EYU25788.1| hypothetical protein MIMGU_mgv1a027166mg, partial [Erythranthe guttata] Length = 471 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +2 Query: 587 KYFFTIFLFSMII-GGQLYVDGLGCNWGLQATHPLSPDIVV 706 KY F + L ++ + G +L+ DGLGCNWG QATHPL PDIVV Sbjct: 5 KYLFVLVLTNVFLFGDRLFADGLGCNWGTQATHPLRPDIVV 45