BLASTX nr result
ID: Rehmannia27_contig00052913
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00052913 (534 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087633.1| PREDICTED: uncharacterized protein LOC105169... 67 7e-10 emb|CDO97642.1| unnamed protein product [Coffea canephora] 55 1e-06 gb|EYU35025.1| hypothetical protein MIMGU_mgv1a021997mg [Erythra... 56 3e-06 >ref|XP_011087633.1| PREDICTED: uncharacterized protein LOC105169064 [Sesamum indicum] Length = 432 Score = 66.6 bits (161), Expect = 7e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 AIRARSAAEMRAFRNRWNKAVKEDECWVDPFEQ 101 AIR RS AEMR FRNRWNKAVKED+CWVDPFEQ Sbjct: 392 AIRTRSYAEMREFRNRWNKAVKEDQCWVDPFEQ 424 >emb|CDO97642.1| unnamed protein product [Coffea canephora] Length = 127 Score = 54.7 bits (130), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +3 Query: 3 AIRARSAAEMRAFRNRWNKAVKEDECWVDPFEQQ 104 A+R +S EMR FR RWNKAVK D+CWVDP+ Q Sbjct: 88 AVRRQSYIEMRIFRRRWNKAVKADQCWVDPYNNQ 121 >gb|EYU35025.1| hypothetical protein MIMGU_mgv1a021997mg [Erythranthe guttata] Length = 339 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/39 (56%), Positives = 32/39 (82%) Frame = +3 Query: 6 IRARSAAEMRAFRNRWNKAVKEDECWVDPFEQQNVT*QT 122 IR RS EMR F++RW+KAVK+D+CW+DPFE+++ +T Sbjct: 300 IRQRSYEEMRVFKSRWSKAVKDDKCWIDPFEKRDAPDRT 338