BLASTX nr result
ID: Rehmannia27_contig00052626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00052626 (821 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK78183.1| hypothetical chloroplast RF2 (plastid) [Gisekia a... 110 1e-23 ref|YP_009117265.1| hypothetical chloroplast RF21 (chloroplast) ... 108 5e-23 gb|AIW05901.1| hypothetical chloroplast protein [Rhabdadenia bif... 108 5e-23 ref|YP_009221851.1| hypothetical chloroplast RF21 (chloroplast) ... 108 6e-23 gb|AEK78199.1| hypothetical chloroplast RF2 (plastid) [Bougainvi... 108 6e-23 gb|AEK78255.1| hypothetical chloroplast RF2 (plastid) [Phytolacc... 108 6e-23 gb|AEK78231.1| hypothetical chloroplast RF2 (plastid) [Mirabilis... 108 6e-23 gb|AEK71525.1| hypothetical chloroplast RF2 [Neurada procumbens] 108 6e-23 gb|AEK71511.1| hypothetical chloroplast RF2 [Lythrum flagellare] 108 6e-23 gb|AMP43610.1| Ycf2 (chloroplast) [Lagerstroemia fauriei] gi|100... 108 6e-23 gb|ADD30894.1| putative RF2 protein (chloroplast) [Gunnera manic... 107 8e-23 gb|AEK78275.1| hypothetical chloroplast RF2, partial (plastid) [... 107 1e-22 gb|KJB30916.1| hypothetical protein B456_005G1676002, partial [G... 100 1e-22 ref|YP_009240857.1| ycf2 (chloroplast) [Diplopanax stachyanthus]... 107 2e-22 ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lat... 107 2e-22 gb|AJS14462.1| hypothetical chloroplast RF21 [Ruellia breedlovei] 107 2e-22 ref|YP_009108887.1| hypothetical chloroplast protein [Pentalinon... 107 2e-22 gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Barts... 107 2e-22 gb|AEK71584.1| hypothetical chloroplast RF2 [Tapiscia sinensis] 107 2e-22 gb|AEK71564.1| hypothetical chloroplast RF2 [Ruptiliocarpon cara... 107 2e-22 >gb|AEK78183.1| hypothetical chloroplast RF2 (plastid) [Gisekia africana] Length = 2275 Score = 110 bits (275), Expect = 1e-23 Identities = 58/84 (69%), Positives = 62/84 (73%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR KQ FCLK CVEKG+M RTFQ AFS LSKW Sbjct: 1160 LHQYLNFNSNMGLIYTPCSEKYLPSEKRKKQSFCLKKCVEKGQMYRTFQRDSAFSTLSKW 1219 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1220 NLFQTYMPWFLTSTGYKYLNLIFL 1243 >ref|YP_009117265.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] gi|752789850|ref|YP_009117284.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] gi|748013949|gb|AJE28419.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] gi|748013968|gb|AJE28438.1| hypothetical chloroplast RF21 (chloroplast) [Premna microphylla] Length = 2296 Score = 108 bits (270), Expect = 5e-23 Identities = 57/78 (73%), Positives = 59/78 (75%), Gaps = 2/78 (2%) Frame = +1 Query: 472 LNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKWNLCQTY 645 LN NMGLI CSE+YLPSEKR K+ CLK CVEKGRM RTFQ AFS LSKWNL QTY Sbjct: 1170 LNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGRMYRTFQRDSAFSTLSKWNLFQTY 1229 Query: 646 MTLFLTSTGYTCLNLILL 699 M FLTSTGY LNLI L Sbjct: 1230 MPWFLTSTGYKYLNLIFL 1247 >gb|AIW05901.1| hypothetical chloroplast protein [Rhabdadenia biflora] gi|702076040|gb|AIW05918.1| hypothetical chloroplast protein [Rhabdadenia biflora] Length = 2296 Score = 108 bits (270), Expect = 5e-23 Identities = 57/84 (67%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR KQ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1173 LHQYLNFNSNMGLIHTPCSEKYLPSEKRKKQSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1232 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1233 NLFQTYMPWFLTSTGYKYLNLIFL 1256 >ref|YP_009221851.1| hypothetical chloroplast RF21 (chloroplast) [Mesembryanthemum crystallinum] gi|693301893|gb|AIS35727.1| hypothetical chloroplast RF21 (chloroplast) [Mesembryanthemum crystallinum] Length = 1792 Score = 108 bits (269), Expect = 6e-23 Identities = 57/84 (67%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR KQ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1013 LHQYLNFNSNMGLIYTPCSEKYLPSEKRKKQSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1072 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1073 NLFQTYMPWFLTSTGYKYLNLIFL 1096 >gb|AEK78199.1| hypothetical chloroplast RF2 (plastid) [Bougainvillea glabra] Length = 2189 Score = 108 bits (269), Expect = 6e-23 Identities = 57/84 (67%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR KQ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1076 LHQYLNFNSNMGLIYTPCSEKYLPSEKRKKQSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1135 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1136 NLFQTYMPWFLTSTGYKYLNLIFL 1159 >gb|AEK78255.1| hypothetical chloroplast RF2 (plastid) [Phytolacca americana] Length = 2259 Score = 108 bits (269), Expect = 6e-23 Identities = 57/84 (67%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR KQ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1160 LHQYLNFNSNMGLIYTPCSEKYLPSEKRKKQSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1219 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1220 NLFQTYMPWFLTSTGYKYLNLIFL 1243 >gb|AEK78231.1| hypothetical chloroplast RF2 (plastid) [Mirabilis jalapa] Length = 2269 Score = 108 bits (269), Expect = 6e-23 Identities = 57/84 (67%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR KQ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1154 LHQYLNFNSNMGLIYTPCSEKYLPSEKRKKQSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1213 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1214 NLFQTYMPWFLTSTGYKYLNLIFL 1237 >gb|AEK71525.1| hypothetical chloroplast RF2 [Neurada procumbens] Length = 2273 Score = 108 bits (269), Expect = 6e-23 Identities = 57/84 (67%), Positives = 62/84 (73%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ LN NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1163 LHQYLNLNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGQMGRTFQGDSAFSTLSKW 1222 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1223 NLFQTYMPWFLTSTGYKYLNLIFL 1246 >gb|AEK71511.1| hypothetical chloroplast RF2 [Lythrum flagellare] Length = 2278 Score = 108 bits (269), Expect = 6e-23 Identities = 57/84 (67%), Positives = 60/84 (71%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 LY+ N NMGLI CSE+YLPSEKR K CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1165 LYQYLNFNSNMGLIHTPCSEKYLPSEKRKKPSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1224 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1225 NLFQTYMPWFLTSTGYKYLNLIFL 1248 >gb|AMP43610.1| Ycf2 (chloroplast) [Lagerstroemia fauriei] gi|1004606484|gb|AMP43628.1| Ycf2 (chloroplast) [Lagerstroemia fauriei] Length = 2313 Score = 108 bits (269), Expect = 6e-23 Identities = 57/84 (67%), Positives = 60/84 (71%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 LY+ N NMGLI CSE+YLPSEKR KQ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1176 LYQYLNFNSNMGLIHTPCSEKYLPSEKRKKQSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1235 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LN I L Sbjct: 1236 NLFQTYMPWFLTSTGYKYLNWIFL 1259 >gb|ADD30894.1| putative RF2 protein (chloroplast) [Gunnera manicata] gi|340807148|gb|AEK71744.1| hypothetical chloroplast RF2 [Gunnera manicata] Length = 2306 Score = 107 bits (268), Expect = 8e-23 Identities = 56/84 (66%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ F N NMGLI CSE+YLPSEKR K+ CL CVEKG+M RTFQ AFS LSKW Sbjct: 1165 LHQHFNFNSNMGLIHTPCSEKYLPSEKREKRSLCLNKCVEKGQMYRTFQRDSAFSTLSKW 1224 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1225 NLFQTYMPWFLTSTGYKYLNLIFL 1248 >gb|AEK78275.1| hypothetical chloroplast RF2, partial (plastid) [Sarcobatus vermiculatus] Length = 1831 Score = 107 bits (267), Expect = 1e-22 Identities = 57/84 (67%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR KQ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1076 LHQYLNFNLNMGLIYTPCSEKYLPSEKRKKQSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1135 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1136 NLFQTYMPWFLTSTGYKYLNLIFL 1159 >gb|KJB30916.1| hypothetical protein B456_005G1676002, partial [Gossypium raimondii] Length = 184 Score = 100 bits (250), Expect = 1e-22 Identities = 54/84 (64%), Positives = 59/84 (70%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N N+GLIQ CSE+YLPSEKR KQ CLK VEKG M RTFQ FS LSKW Sbjct: 11 LHQYLNFNSNIGLIQTPCSEKYLPSEKRKKQSLCLKKYVEKGWMYRTFQRDSTFSTLSKW 70 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY +NLI L Sbjct: 71 NLFQTYMPWFLTSTGYKYINLIFL 94 >ref|YP_009240857.1| ycf2 (chloroplast) [Diplopanax stachyanthus] gi|1011058454|ref|YP_009240838.1| ycf2 (chloroplast) [Diplopanax stachyanthus] gi|757813451|gb|AJO25201.1| ycf2 (chloroplast) [Diplopanax stachyanthus] gi|757813452|gb|AJO25202.1| ycf2 (chloroplast) [Diplopanax stachyanthus] Length = 2086 Score = 107 bits (266), Expect = 2e-22 Identities = 56/84 (66%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 966 LHQYLNFNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1025 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1026 NLFQTYMPWFLTSTGYKYLNLIFL 1049 >ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|927372320|ref|YP_009164611.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590319|gb|AJD76835.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590327|gb|AJD76843.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] Length = 2261 Score = 107 bits (266), Expect = 2e-22 Identities = 56/78 (71%), Positives = 59/78 (75%), Gaps = 2/78 (2%) Frame = +1 Query: 472 LNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKWNLCQTY 645 LN NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKWNL QTY Sbjct: 1163 LNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQTY 1222 Query: 646 MTLFLTSTGYTCLNLILL 699 M FLTSTGY LNLI L Sbjct: 1223 MPWFLTSTGYKYLNLIFL 1240 >gb|AJS14462.1| hypothetical chloroplast RF21 [Ruellia breedlovei] Length = 2266 Score = 107 bits (266), Expect = 2e-22 Identities = 56/78 (71%), Positives = 59/78 (75%), Gaps = 2/78 (2%) Frame = +1 Query: 472 LNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKWNLCQTY 645 LN NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKWNL QTY Sbjct: 1173 LNSNMGLIHTPCSEKYLPSEKRRKRSLCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQTY 1232 Query: 646 MTLFLTSTGYTCLNLILL 699 M FLTSTGY LNLI L Sbjct: 1233 MPWFLTSTGYKYLNLIFL 1250 >ref|YP_009108887.1| hypothetical chloroplast protein [Pentalinon luteum] gi|728792527|ref|YP_009108904.1| hypothetical chloroplast protein [Pentalinon luteum] gi|702075851|gb|AIW05731.1| hypothetical chloroplast protein [Pentalinon luteum] gi|702075868|gb|AIW05748.1| hypothetical chloroplast protein [Pentalinon luteum] Length = 2269 Score = 107 bits (266), Expect = 2e-22 Identities = 56/84 (66%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1172 LHQYLNFNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1231 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1232 NLFQTYMPWFLTSTGYKYLNLIFL 1255 >gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] gi|576598331|gb|AHH30493.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] Length = 2269 Score = 107 bits (266), Expect = 2e-22 Identities = 56/78 (71%), Positives = 59/78 (75%), Gaps = 2/78 (2%) Frame = +1 Query: 472 LNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKWNLCQTY 645 LN NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKWNL QTY Sbjct: 1167 LNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQTY 1226 Query: 646 MTLFLTSTGYTCLNLILL 699 M FLTSTGY LNLI L Sbjct: 1227 MPWFLTSTGYKYLNLIFL 1244 >gb|AEK71584.1| hypothetical chloroplast RF2 [Tapiscia sinensis] Length = 2269 Score = 107 bits (266), Expect = 2e-22 Identities = 56/84 (66%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1165 LHQYLNFNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1224 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1225 NLFQTYMPWFLTSTGYKYLNLIFL 1248 >gb|AEK71564.1| hypothetical chloroplast RF2 [Ruptiliocarpon caracolito] Length = 2269 Score = 107 bits (266), Expect = 2e-22 Identities = 56/84 (66%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +1 Query: 454 LYRPFTLNPNMGLIQALCSEEYLPSEKRGKQCFCLKNCVEKGRMCRTFQ--LAFSFLSKW 627 L++ N NMGLI CSE+YLPSEKR K+ CLK CVEKG+M RTFQ AFS LSKW Sbjct: 1164 LHQYLNFNSNMGLIHTPCSEKYLPSEKRKKRSLCLKKCVEKGQMYRTFQRDSAFSTLSKW 1223 Query: 628 NLCQTYMTLFLTSTGYTCLNLILL 699 NL QTYM FLTSTGY LNLI L Sbjct: 1224 NLFQTYMPWFLTSTGYKYLNLIFL 1247