BLASTX nr result
ID: Rehmannia27_contig00052448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00052448 (437 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU38105.1| hypothetical protein Varpa_3932 [Variovorax parad... 64 3e-10 ref|WP_055805767.1| hypothetical protein [Variovorax sp. Root318... 55 6e-07 >gb|ADU38105.1| hypothetical protein Varpa_3932 [Variovorax paradoxus EPS] Length = 143 Score = 63.9 bits (154), Expect = 3e-10 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +3 Query: 303 LKCRTILAFTLVCALVA*-RTAPLYGPSRRALITGEEDEERTVVGQ 437 +KCR I A LVCA +A RTAPLY P+RRAL+T EEDEERT+VGQ Sbjct: 1 MKCRAIFAAALVCATLAGCRTAPLYEPTRRALVTAEEDEERTIVGQ 46 >ref|WP_055805767.1| hypothetical protein [Variovorax sp. Root318D1] gi|945427238|gb|KQU83511.1| hypothetical protein ASC78_12730 [Variovorax sp. Root318D1] Length = 143 Score = 55.1 bits (131), Expect = 6e-07 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +3 Query: 303 LKCRTILAFTLVC-ALVA*RTAPLYGPSRRALITGEEDEERTVVGQ 437 +K ++I A C AL A RTAPLY P+RRAL+ EEDEERTVVGQ Sbjct: 1 MKYQSICAAVFACVALAACRTAPLYEPTRRALVAAEEDEERTVVGQ 46