BLASTX nr result
ID: Rehmannia27_contig00052379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00052379 (755 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107282.1| hypothetical protein L484_000314 [Morus nota... 53 6e-06 >ref|XP_010107282.1| hypothetical protein L484_000314 [Morus notabilis] gi|703146554|ref|XP_010108830.1| hypothetical protein L484_020566 [Morus notabilis] gi|587933370|gb|EXC20345.1| hypothetical protein L484_020566 [Morus notabilis] gi|587969290|gb|EXC54276.1| hypothetical protein L484_000314 [Morus notabilis] Length = 76 Score = 52.8 bits (125), Expect = 6e-06 Identities = 33/77 (42%), Positives = 42/77 (54%) Frame = +1 Query: 397 IDMEGQKESLREVQAKKRPTEELRDETEVKCSSNIKGYEKGTNEDKSSTNKGTQDEVKGL 576 +D + +K E Q K + D +S + E G N++K T KG Q E KGL Sbjct: 1 MDAKDKKLQSSENQTAKEVKGVIEDSPNTNNTSQRESME-GKNDNK--TVKGKQQEPKGL 57 Query: 577 PHQQVPQPSDFSSQALE 627 PHQQV QP DFSS+ALE Sbjct: 58 PHQQVAQPGDFSSEALE 74