BLASTX nr result
ID: Rehmannia27_contig00052270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00052270 (466 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-15 ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-15 ref|XP_015057317.1| PREDICTED: pentatricopeptide repeat-containi... 76 2e-13 ref|XP_012837736.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-12 ref|XP_004250478.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-12 emb|CDO99888.1| unnamed protein product [Coffea canephora] 69 7e-11 ref|XP_006436646.1| hypothetical protein CICLE_v10030857mg [Citr... 67 2e-10 gb|EYU37193.1| hypothetical protein MIMGU_mgv1a021143mg [Erythra... 63 7e-09 gb|KDO42139.1| hypothetical protein CISIN_1g005881mg [Citrus sin... 62 2e-08 ref|XP_010242606.1| PREDICTED: pentatricopeptide repeat-containi... 61 5e-08 ref|XP_011102135.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-08 ref|XP_015876554.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 ref|XP_011621127.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-07 gb|KNA18887.1| hypothetical protein SOVF_066900 [Spinacia oleracea] 55 3e-06 ref|XP_007010243.1| Pentatricopeptide repeat-containing protein ... 55 3e-06 ref|XP_010277874.1| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 ref|XP_012447968.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 >ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Nicotiana sylvestris] Length = 698 Score = 82.4 bits (202), Expect = 1e-15 Identities = 53/153 (34%), Positives = 82/153 (53%), Gaps = 2/153 (1%) Frame = -2 Query: 459 TNSIINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNLV 286 + S++N +A++A+L+ G K F NH M L+ Q+LFD+MP RN++ Sbjct: 13 SKSLLNGKAVHAKLLKFG-----SKANVFTNNHLLAMYLKLNQFDDAQRLFDRMPERNII 67 Query: 285 KLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL*TGRRIHE 106 ++ I ++ K + L+ G V A+ AC + A TG+ +H Sbjct: 68 SW-TTLISTYSQMGMSEKALDCFRSMVLEDGFAPNGYTYVAALSACTSLGAERTGKELHG 126 Query: 105 RIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 R+YR E ++NSF+ NCLV FYGKCGLLK ++V Sbjct: 127 RMYRTEESLNSFVTNCLVNFYGKCGLLKSARLV 159 >ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Nicotiana tomentosiformis] Length = 698 Score = 81.3 bits (199), Expect = 4e-15 Identities = 54/163 (33%), Positives = 85/163 (52%), Gaps = 12/163 (7%) Frame = -2 Query: 459 TNSIINDEAIYARLMVSGFPPRRPKEQTFLRNHN--MQLETLTTLMVQKLFDKMPVRNLV 286 + S++N +A++A+L+ G P ++ NH M L+ Q+L D+MP RN++ Sbjct: 13 SKSLLNGKAVHAQLLKFGSKP-----DVYINNHLLVMYLKLNQFADAQQLLDRMPERNII 67 Query: 285 KLDSSNILVFNW----------GCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTR 136 S L+ + GC+R+ + L+ G V A+ AC + Sbjct: 68 ---SWTTLISTYSQKGMSEKALGCFRS--------MVLEDGFAPNGYTYVAALSACTSLG 116 Query: 135 AL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 A TG+ +H R+YR E ++NSF+ NCLV FYGKCGLLK ++V Sbjct: 117 AERTGKELHGRMYRTEESLNSFVTNCLVNFYGKCGLLKSARLV 159 >ref|XP_015057317.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Solanum pennellii] Length = 702 Score = 76.3 bits (186), Expect = 2e-13 Identities = 53/160 (33%), Positives = 84/160 (52%), Gaps = 9/160 (5%) Frame = -2 Query: 459 TNSIINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNLV 286 + S+ N ++++A+L+ G K F NH M L+ Q+LFD+MP RN++ Sbjct: 13 SKSLFNGKSLHAQLLKLG----SLKADIFTNNHLLTMYLKLNQFDDAQQLFDRMPERNII 68 Query: 285 KLDS-----SNILVFN--WGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL* 127 + S + ++ GC+R+ + L+ G V A+ AC + A Sbjct: 69 SWTTLISTYSQLGMYEKALGCFRS--------MNLEDGFGPNGYTYVAALSACSSLGAER 120 Query: 126 TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 TG+ +H R+ R E ++NSF+ NCLV FYGKCGLLK ++V Sbjct: 121 TGKELHGRMLRTEESLNSFVSNCLVNFYGKCGLLKSARIV 160 >ref|XP_012837736.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Erythranthe guttata] Length = 648 Score = 73.9 bits (180), Expect = 1e-12 Identities = 51/155 (32%), Positives = 79/155 (50%), Gaps = 2/155 (1%) Frame = -2 Query: 465 AQTNSIINDEAIYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLM--VQKLFDKMPVRN 292 A SI N +AI+ARL++SG NH + + + + QKLFD+M VRN Sbjct: 11 AAKKSIFNGKAIHARLIISGLD-----RDVQTNNHLLSMYSKIGYIGYAQKLFDEMLVRN 65 Query: 291 LVKLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL*TGRRI 112 ++ +S I ++ K + L G+ V A+ AC AL G+ I Sbjct: 66 VITW-TSLISAYSQLGLSEKALSCFQLMVLDDGIAPNEYTFVAAISACAQVGALRNGKEI 124 Query: 111 HERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 H ++YR+E +N+F+ N L+ FYGKCG L+ ++V Sbjct: 125 HGKMYRSEETVNTFVNNSLINFYGKCGSLESARLV 159 >ref|XP_004250478.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Solanum lycopersicum] Length = 702 Score = 72.4 bits (176), Expect = 5e-12 Identities = 53/163 (32%), Positives = 81/163 (49%), Gaps = 12/163 (7%) Frame = -2 Query: 459 TNSIINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNLV 286 + S+ N ++++A+L+ G K F NH M L+ Q+LFD+MP RN++ Sbjct: 13 SKSLFNGKSLHAQLLKLG----SLKADIFTNNHLLTMYLKLNQFDDAQQLFDRMPERNII 68 Query: 285 KLDSSNILVFNW----------GCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTR 136 S L+ + GC+R+ + L+ G V A+ AC + Sbjct: 69 ---SWTTLISTYTQLGMYEKALGCFRS--------MNLEDGFGPNGYTYVAALSACSSLG 117 Query: 135 AL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 A TG+ +H R+ R E +NSF+ NCLV FYGKCGLL ++V Sbjct: 118 AERTGKELHGRMLRTEERLNSFVSNCLVNFYGKCGLLISARIV 160 >emb|CDO99888.1| unnamed protein product [Coffea canephora] Length = 637 Score = 68.9 bits (167), Expect = 7e-11 Identities = 33/62 (53%), Positives = 43/62 (69%) Frame = -2 Query: 195 GLLQISNICVGAVLACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFT 16 G L + VGA+ AC NTRA+ G+ IH RIYR + ++NSF+ N LV FYGKCGLLK Sbjct: 36 GFLPNEHTYVGAISACVNTRAVSIGKEIHGRIYRTQDSLNSFVSNSLVNFYGKCGLLKSA 95 Query: 15 KV 10 ++ Sbjct: 96 RL 97 >ref|XP_006436646.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] gi|567888250|ref|XP_006436647.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] gi|568878438|ref|XP_006492198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468913|ref|XP_015380606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468915|ref|XP_015380607.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468917|ref|XP_015380608.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468919|ref|XP_015380609.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468921|ref|XP_015380610.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|557538842|gb|ESR49886.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] gi|557538843|gb|ESR49887.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] Length = 697 Score = 67.4 bits (163), Expect = 2e-10 Identities = 49/166 (29%), Positives = 80/166 (48%), Gaps = 18/166 (10%) Frame = -2 Query: 450 IINDEAIYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLM--VQKLFDKMPVRNLVKLD 277 I+ ++A+++ SGF P NH + + + + QKLFD+MP RN++ Sbjct: 16 ILKGRTLHAKMITSGFHPN-----VITYNHLLLMYVKFSRINDAQKLFDEMPERNVI--- 67 Query: 276 SSNILVFNWGCWRNKP*FVSGQLFLQMGLLQIS------NIC----------VGAVLACD 145 +W +SG F Q+G+ +++ +C VGAV AC Sbjct: 68 -------SWSA------LISG--FSQIGMPEVALNYFRLMVCCVLEPNYYTYVGAVSACA 112 Query: 144 NTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 + +G+ IH R+YR+ + +NS + NCL+ YGKCGLL + V Sbjct: 113 SRGDARSGKEIHGRMYRSGLELNSHVSNCLINMYGKCGLLSSAQFV 158 >gb|EYU37193.1| hypothetical protein MIMGU_mgv1a021143mg [Erythranthe guttata] Length = 605 Score = 63.2 bits (152), Expect = 7e-09 Identities = 38/106 (35%), Positives = 58/106 (54%) Frame = -2 Query: 324 QKLFDKMPVRNLVKLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACD 145 QKLFD+M VRN++ +S I ++ K + L G+ V A+ AC Sbjct: 12 QKLFDEMLVRNVITW-TSLISAYSQLGLSEKALSCFQLMVLDDGIAPNEYTFVAAISACA 70 Query: 144 NTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 AL G+ IH ++YR+E +N+F+ N L+ FYGKCG L+ ++V Sbjct: 71 QVGALRNGKEIHGKMYRSEETVNTFVNNSLINFYGKCGSLESARLV 116 >gb|KDO42139.1| hypothetical protein CISIN_1g005881mg [Citrus sinensis] Length = 672 Score = 62.0 bits (149), Expect = 2e-08 Identities = 41/122 (33%), Positives = 62/122 (50%), Gaps = 16/122 (13%) Frame = -2 Query: 324 QKLFDKMPVRNLVKLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQIS------NIC-- 169 QKLFD+MP RN++ +W +SG F Q+G+ +++ +C Sbjct: 30 QKLFDEMPERNVI----------SWSA------LISG--FSQIGMPEVALNYFRLMVCCV 71 Query: 168 --------VGAVLACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTK 13 VGAV AC + +G+ IH R+YR+ + +NS + NCL+ YGKCGLL + Sbjct: 72 LEPNYYTYVGAVSACASRGDARSGKEIHGRMYRSGLELNSHVSNCLINMYGKCGLLSSAQ 131 Query: 12 VV 7 V Sbjct: 132 FV 133 >ref|XP_010242606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Nelumbo nucifera] Length = 697 Score = 60.8 bits (146), Expect = 5e-08 Identities = 47/159 (29%), Positives = 76/159 (47%), Gaps = 7/159 (4%) Frame = -2 Query: 462 QTNSIINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNL 289 +T ++ ++A ++ SGF + NH +M ++ ++L +++P RNL Sbjct: 12 ETGCVLKGRTVHAMIITSGF-----SLDVYTSNHLVSMYVKFGRFDDARRLLNQLPDRNL 66 Query: 288 VKLDSSNILVFNWGCWRNKP*FVSGQL-----FLQMGLLQISNICVGAVLACDNTRAL*T 124 V S +L+ + R F L + G+ V A+ AC NT A T Sbjct: 67 V---SWTVLIAGYSQAR----FAEEALDCFRSMVAEGINPNHYTYVSAISACANTGAART 119 Query: 123 GRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 G+ +H +IYR E NSF+ NCLV Y KC L+K ++V Sbjct: 120 GKEVHGKIYRTEQEPNSFVDNCLVNLYVKCRLMKSAQLV 158 >ref|XP_011102135.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Sesamum indicum] Length = 588 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = -2 Query: 168 VGAVLACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 V A+ AC AL G+ IH RIYR E +NSF+ N LV YGKCGLLK ++V Sbjct: 46 VAAISACARVGALRNGKEIHGRIYRREETVNSFVNNSLVNLYGKCGLLKSARLV 99 >ref|XP_015876554.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Ziziphus jujuba] Length = 703 Score = 59.7 bits (143), Expect = 1e-07 Identities = 49/160 (30%), Positives = 70/160 (43%), Gaps = 18/160 (11%) Frame = -2 Query: 432 IYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLMV--QKLFDKMPVRNLVKLDSSNILV 259 ++ +++ SGF P + NH + + T MV + LF+ MP RN V Sbjct: 22 VHGKIITSGFCP-----DVYTNNHLLSMYTKFKRMVDARNLFEIMPERNFV--------- 67 Query: 258 FNWGCWRNKP*FVSGQLFLQMGLLQISNIC----------------VGAVLACDNTRAL* 127 +W +SG + QMG+ + + C VGA+ AC T Sbjct: 68 -SWTA------LISG--YSQMGMAEEALECFRLMVNDGFSPNDYTYVGAISACARTGNAR 118 Query: 126 TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 G+ IH RIYR E + S + N LV YGKCGLL +V Sbjct: 119 YGKAIHGRIYRMEKELGSLVNNSLVNMYGKCGLLNSAGLV 158 >ref|XP_011621127.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Amborella trichopoda] Length = 652 Score = 57.8 bits (138), Expect = 5e-07 Identities = 41/139 (29%), Positives = 72/139 (51%), Gaps = 5/139 (3%) Frame = -2 Query: 432 IYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLM--VQKLFDKMPVRNLVKLDSSNILV 259 ++A ++VSGF P +L NH M + + + + LFDKMP R+ V ++ Sbjct: 6 LHAHVIVSGFQP-----DLYLSNHLMNMYSKCGCLDDARNLFDKMPHRDSVSYNTMIACY 60 Query: 258 FNWGCWRNKP*FVSGQLFLQMGLL--QISNICVGAVL-ACDNTRAL*TGRRIHERIYRAE 88 +G N + ++F M L ++ + V +V+ AC N L GR++H + + Sbjct: 61 DKYGPCEN-----ALEVFRAMKLSGSKVDHFTVSSVISACMNISFLCQGRQVHSDVIKIG 115 Query: 87 VNINSFLFNCLVKFYGKCG 31 + +N ++ + LV+FYGKCG Sbjct: 116 IGLNVYVGSALVEFYGKCG 134 >gb|KNA18887.1| hypothetical protein SOVF_066900 [Spinacia oleracea] Length = 610 Score = 55.5 bits (132), Expect = 3e-06 Identities = 38/108 (35%), Positives = 56/108 (51%), Gaps = 3/108 (2%) Frame = -2 Query: 321 KLFDKMPVRNLVKLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISN---ICVGAVLA 151 K+F+KMPV+NLV +S V N KP V + F +M L+ + V + A Sbjct: 193 KVFEKMPVKNLVTWNS----VINGFALNGKPNEVL-KFFREMSLVGVEPDGFTMVSLLCA 247 Query: 150 CDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 C AL GRR+H +++ +N N N L+ FY KCG ++ K+V Sbjct: 248 CAELGALALGRRVHVYMFKVGLNENLHAGNALLDFYAKCGRIREAKMV 295 >ref|XP_007010243.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] gi|508727156|gb|EOY19053.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] Length = 671 Score = 55.5 bits (132), Expect = 3e-06 Identities = 47/169 (27%), Positives = 77/169 (45%), Gaps = 18/169 (10%) Frame = -2 Query: 459 TNSIINDEAIYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLMV--QKLFDKMPVRNLV 286 T SI N A++A+++ S + NH + + +V +K+FD MP RN++ Sbjct: 14 TRSIRNGIALHAKIITSQI-----SRDIYTNNHLLAMYVKFNRIVDARKVFDGMPERNVI 68 Query: 285 KLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNIC----------------VGAVL 154 +W +SG + QMG+ + + C V AV Sbjct: 69 ----------SWTA------LISG--YSQMGMAEKALDCLSLMVSDDLEPNYYTFVSAVS 110 Query: 153 ACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 AC + G+ +H RIYR+ V+ ++ + N L+ YGKCGLLK ++V Sbjct: 111 ACASLGDGSVGKEVHGRIYRSGVDFSTPVCNSLINMYGKCGLLKSAQLV 159 >ref|XP_010277874.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Nelumbo nucifera] Length = 496 Score = 55.1 bits (131), Expect = 4e-06 Identities = 39/105 (37%), Positives = 63/105 (60%), Gaps = 3/105 (2%) Frame = -2 Query: 324 QKLFDKMPVRNLVKLDSSNILVFNWGCWRNKP*FVSGQLF--LQMGLLQISNICVGAVL- 154 ++LF++MP ++ V S N L+ G +NK + +LF +Q+ ++ + + + +VL Sbjct: 195 RRLFEEMPEKDAV---SWNSLIA--GYVQNKDYRGALELFHEMQVNGVEATEVTLISVLG 249 Query: 153 ACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKF 19 AC T AL GR+IH+ + + E+ I FL N LV Y KCG+LKF Sbjct: 250 ACAETGALEIGRKIHDFLKQKELKIEGFLGNALVDMYAKCGILKF 294 >ref|XP_012447968.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Gossypium raimondii] gi|823230485|ref|XP_012447969.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Gossypium raimondii] gi|823230487|ref|XP_012447970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Gossypium raimondii] gi|763793388|gb|KJB60384.1| hypothetical protein B456_009G302600 [Gossypium raimondii] gi|763793389|gb|KJB60385.1| hypothetical protein B456_009G302600 [Gossypium raimondii] gi|763793390|gb|KJB60386.1| hypothetical protein B456_009G302600 [Gossypium raimondii] Length = 699 Score = 55.1 bits (131), Expect = 5e-06 Identities = 45/169 (26%), Positives = 78/169 (46%), Gaps = 18/169 (10%) Frame = -2 Query: 459 TNSIINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNLV 286 T SI A++A++++SG P + NH M + L +K+ ++MP RN++ Sbjct: 14 TRSISKGRALHAKIIISGMP-----RDIYTNNHLLAMYVRFDRILDARKVLEEMPERNVI 68 Query: 285 KLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNIC----------------VGAVL 154 +W +SG + Q+G+ + + C V AV Sbjct: 69 ----------SWTA------LISG--YSQVGMPEKALDCFSLMINDGVEPNYYTFVSAVS 110 Query: 153 ACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 7 AC + G+ +H +IYR+ V+ ++ + N L+ YGKCGLLK ++V Sbjct: 111 ACASLGDGRAGKEVHGKIYRSGVDFSTPVSNSLINMYGKCGLLKSAQLV 159