BLASTX nr result
ID: Rehmannia27_contig00052210
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00052210 (386 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL77445.1|L78468_1 acyl-ACP thioesterase [Perilla frutescens] 58 2e-07 ref|XP_012833543.1| PREDICTED: oleoyl-acyl carrier protein thioe... 57 3e-07 gb|AIU99496.1| Acyl-ACP Thioesterase A [Salvia miltiorrhiza] 57 4e-07 ref|XP_011089673.1| PREDICTED: oleoyl-acyl carrier protein thioe... 55 2e-06 ref|XP_004290189.1| PREDICTED: oleoyl-acyl carrier protein thioe... 55 3e-06 ref|XP_007199939.1| hypothetical protein PRUPE_ppa007110mg [Prun... 54 4e-06 ref|XP_009379360.1| PREDICTED: oleoyl-acyl carrier protein thioe... 54 5e-06 ref|XP_009371919.1| PREDICTED: oleoyl-acyl carrier protein thioe... 54 5e-06 ref|XP_008372503.1| PREDICTED: oleoyl-acyl carrier protein thioe... 54 5e-06 >gb|AAL77445.1|L78468_1 acyl-ACP thioesterase [Perilla frutescens] Length = 368 Score = 57.8 bits (138), Expect = 2e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +1 Query: 16 QGINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 QG NG +A D+N +LQF HLLR+S+ DGSE NRGRT WRKK Sbjct: 323 QGTNGSPTAAKDENDYLQFLHLLRIST-DGSEINRGRTEWRKK 364 >ref|XP_012833543.1| PREDICTED: oleoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] gi|604341269|gb|EYU40621.1| hypothetical protein MIMGU_mgv1a008340mg [Erythranthe guttata] Length = 377 Score = 57.4 bits (137), Expect = 3e-07 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = +1 Query: 7 SEHQGINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKKLPA 153 SE NG +A D+N LQF HLLRLS+ DGSE NRGRT WRKK PA Sbjct: 328 SELHATNGTPNAAKDENECLQFLHLLRLSN-DGSEINRGRTEWRKKKPA 375 >gb|AIU99496.1| Acyl-ACP Thioesterase A [Salvia miltiorrhiza] Length = 370 Score = 57.0 bits (136), Expect = 4e-07 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +1 Query: 16 QGINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 QG NG +A D+N LQF HLLRLS+ DGSE NRGRT WRKK Sbjct: 325 QGTNGSAAAARDENNCLQFLHLLRLSN-DGSEINRGRTEWRKK 366 >ref|XP_011089673.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic [Sesamum indicum] Length = 376 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +1 Query: 7 SEHQGINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 S+ G NG +A D++ +LQF HLLR+S+ DGSE NRGRT WRKK Sbjct: 328 SQLHGTNGSPTAAKDESDYLQFLHLLRISN-DGSEINRGRTEWRKK 372 >ref|XP_004290189.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic [Fragaria vesca subsp. vesca] Length = 379 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +1 Query: 16 QGINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 +G NG ++++ N + QF HLLR+S GDGSE NRGRT+WRKK Sbjct: 335 KGTNGSPAASENRNDYRQFLHLLRIS-GDGSEINRGRTVWRKK 376 >ref|XP_007199939.1| hypothetical protein PRUPE_ppa007110mg [Prunus persica] gi|462395339|gb|EMJ01138.1| hypothetical protein PRUPE_ppa007110mg [Prunus persica] gi|723592147|gb|AIX97816.1| fatty acyl-ACP thioesterase A [Prunus sibirica] Length = 381 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +1 Query: 16 QGINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 +G NG + +D + QF HLLRLS GDGSE NRGRT+WR+K Sbjct: 337 EGTNGSPAATEDTKDYCQFLHLLRLS-GDGSEINRGRTVWREK 378 >ref|XP_009379360.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic-like [Pyrus x bretschneideri] Length = 379 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +1 Query: 19 GINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 G NG + +DD + Q+ HLLR S+GDGSE NRGRTIWR+K Sbjct: 336 GTNGSLAATEDDKDYRQYLHLLR-SAGDGSEINRGRTIWREK 376 >ref|XP_009371919.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic [Pyrus x bretschneideri] Length = 379 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +1 Query: 19 GINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 G NG + +DD + Q+ HLLRL+ GDGSE NRGRTIWR+K Sbjct: 336 GTNGSPTATEDDKDYRQYLHLLRLA-GDGSEINRGRTIWREK 376 >ref|XP_008372503.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic-like [Malus domestica] gi|658021618|ref|XP_008346207.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic-like [Malus domestica] Length = 379 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +1 Query: 19 GINGRTPSADDDNGFLQFRHLLRLSSGDGSETNRGRTIWRKK 144 G NG + +DD + Q+ HLLRL+ GDGSE NRGRTIWR+K Sbjct: 336 GTNGSPTATEDDKDYRQYLHLLRLA-GDGSEINRGRTIWREK 376