BLASTX nr result
ID: Rehmannia27_contig00051405
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00051405 (620 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029052.1| Uncharacterized protein TCM_024962 [Theobrom... 59 2e-08 >ref|XP_007029052.1| Uncharacterized protein TCM_024962 [Theobroma cacao] gi|508717657|gb|EOY09554.1| Uncharacterized protein TCM_024962 [Theobroma cacao] Length = 103 Score = 59.3 bits (142), Expect = 2e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 573 FYFLKSHAFSSSVTLADGSTSHVLGSGTIIPTPSLPLQSVLNL 445 F+ +SH SS+VTLADGST +VLGSGTI PTPS+ L +VLNL Sbjct: 8 FFTFQSHTTSSNVTLADGSTFYVLGSGTINPTPSISLSNVLNL 50