BLASTX nr result
ID: Rehmannia27_contig00050502
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00050502 (359 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319191.2| hypothetical protein POPTR_0013s06200g [Popu... 78 2e-14 ref|XP_011034265.1| PREDICTED: cation/calcium exchanger 1-like [... 78 2e-14 ref|XP_011069968.1| PREDICTED: cation/calcium exchanger 1-like [... 76 6e-14 ref|XP_002325439.2| hypothetical protein POPTR_0019s05670g [Popu... 74 5e-13 ref|XP_012492453.1| PREDICTED: cation/calcium exchanger 1 [Gossy... 74 5e-13 ref|XP_011004774.1| PREDICTED: cation/calcium exchanger 1-like [... 73 7e-13 ref|XP_015970905.1| PREDICTED: cation/calcium exchanger 1 [Arach... 73 7e-13 ref|XP_004489653.1| PREDICTED: cation/calcium exchanger 1-like [... 73 7e-13 gb|KRG94167.1| hypothetical protein GLYMA_19G066700 [Glycine max] 72 2e-12 ref|XP_003555083.1| PREDICTED: cation/calcium exchanger 1-like [... 72 2e-12 ref|XP_007029957.1| Sodium/potassium/calcium exchanger 6 precurs... 72 3e-12 ref|XP_013451524.1| cation calcium exchanger [Medicago truncatul... 70 6e-12 gb|KOM38603.1| hypothetical protein LR48_Vigan03g198500 [Vigna a... 70 9e-12 ref|XP_010054949.1| PREDICTED: cation/calcium exchanger 1 [Eucal... 70 9e-12 ref|XP_007151476.1| hypothetical protein PHAVU_004G049800g [Phas... 69 2e-11 emb|CBI31227.3| unnamed protein product [Vitis vinifera] 69 2e-11 ref|XP_014495983.1| PREDICTED: cation/calcium exchanger 1-like [... 69 2e-11 ref|XP_002270512.2| PREDICTED: cation/calcium exchanger 1-like [... 69 2e-11 ref|XP_004493218.1| PREDICTED: cation/calcium exchanger 1 [Cicer... 69 2e-11 gb|KYP42949.1| Cation/calcium exchanger 4 [Cajanus cajan] 69 3e-11 >ref|XP_002319191.2| hypothetical protein POPTR_0013s06200g [Populus trichocarpa] gi|550325083|gb|EEE95114.2| hypothetical protein POPTR_0013s06200g [Populus trichocarpa] Length = 580 Score = 77.8 bits (190), Expect = 2e-14 Identities = 29/66 (43%), Positives = 45/66 (68%) Frame = +2 Query: 161 KNPILHETNVNSEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSL 340 K+ ++ + + + C+ + + D+ SKC Y++SN GCR KGY+NYL+IFYCTCG L Sbjct: 44 KHSLVLQEELTKTDGCSRIHDYTDYKSKCVYIKSNIGCRSKGYINYLQIFYCTCGKFSML 103 Query: 341 GYFLLL 358 G+ +LL Sbjct: 104 GHVMLL 109 >ref|XP_011034265.1| PREDICTED: cation/calcium exchanger 1-like [Populus euphratica] gi|743940378|ref|XP_011014659.1| PREDICTED: cation/calcium exchanger 1-like [Populus euphratica] Length = 583 Score = 77.8 bits (190), Expect = 2e-14 Identities = 29/66 (43%), Positives = 45/66 (68%) Frame = +2 Query: 161 KNPILHETNVNSEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSL 340 K+ ++ + + + C+ + + D+ SKC Y++SN GCR KGY+NYL+IFYCTCG L Sbjct: 47 KHSLVLQEELTKTDGCSRIHDYTDYKSKCVYIKSNIGCRSKGYINYLQIFYCTCGKFSML 106 Query: 341 GYFLLL 358 G+ +LL Sbjct: 107 GHVMLL 112 >ref|XP_011069968.1| PREDICTED: cation/calcium exchanger 1-like [Sesamum indicum] Length = 585 Score = 76.3 bits (186), Expect = 6e-14 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = +2 Query: 179 ETNVNSEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 + S C+ VR+ D SKC YV+S+S C GKGYLNYL+IFYC+C N+P++GY LL Sbjct: 51 DDQAGSTGTCSDVRELVDRRSKCAYVKSHSSCWGKGYLNYLQIFYCSCMNMPAVGYSALL 110 >ref|XP_002325439.2| hypothetical protein POPTR_0019s05670g [Populus trichocarpa] gi|550316883|gb|EEE99820.2| hypothetical protein POPTR_0019s05670g [Populus trichocarpa] Length = 586 Score = 73.6 bits (179), Expect = 5e-13 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +2 Query: 200 ENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 + C+ + + D+ SKC YV+S+ GCR KGY+NYL+IFYCTCG LGY +LL Sbjct: 61 DGCSGIHDYIDYRSKCIYVKSHIGCRPKGYINYLQIFYCTCGQFSILGYIMLL 113 >ref|XP_012492453.1| PREDICTED: cation/calcium exchanger 1 [Gossypium raimondii] gi|763777338|gb|KJB44461.1| hypothetical protein B456_007G254400 [Gossypium raimondii] Length = 599 Score = 73.6 bits (179), Expect = 5e-13 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = +2 Query: 191 NSEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLL 355 ++ ++C + F D+ KC YVRS GCR KGY+NYL+IFYCTCG P LG+ +L Sbjct: 54 SNNDSCASLHDFTDYKHKCLYVRSEIGCRPKGYINYLQIFYCTCGRFPILGHLVL 108 >ref|XP_011004774.1| PREDICTED: cation/calcium exchanger 1-like [Populus euphratica] Length = 584 Score = 73.2 bits (178), Expect = 7e-13 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +2 Query: 206 CTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 C+ + + D+ SKC YV+S+ GCR KGY+NYL+IFYCTCG LGY +LL Sbjct: 61 CSGIHDYIDYRSKCIYVKSHIGCRPKGYINYLQIFYCTCGQFSMLGYIMLL 111 >ref|XP_015970905.1| PREDICTED: cation/calcium exchanger 1 [Arachis duranensis] Length = 586 Score = 73.2 bits (178), Expect = 7e-13 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S E CT + KF+D +KC YV+++ CR KGY+NYL+IFYC+ GN P LG+ LL+ Sbjct: 56 SVEGCTDLHKFSDDAAKCYYVQTHEDCRSKGYINYLQIFYCSLGNSPVLGHTLLI 110 >ref|XP_004489653.1| PREDICTED: cation/calcium exchanger 1-like [Cicer arietinum] Length = 595 Score = 73.2 bits (178), Expect = 7e-13 Identities = 29/53 (54%), Positives = 42/53 (79%) Frame = +2 Query: 200 ENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 ++CT + F+++TSKC YV+++S CR KGY+NYL+IFYC GN P LG+ LL+ Sbjct: 66 DSCTELHNFSNYTSKCIYVKTHSDCRSKGYINYLQIFYCNLGNSPILGHTLLV 118 >gb|KRG94167.1| hypothetical protein GLYMA_19G066700 [Glycine max] Length = 528 Score = 72.0 bits (175), Expect = 2e-12 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S + CT + K++D+ SKC YV+SN CR KGY+NYL+IFYC+ G+ P LG+ LL+ Sbjct: 6 SVDGCTDLHKYSDYDSKCLYVKSNVHCRSKGYINYLQIFYCSFGHSPILGHSLLV 60 >ref|XP_003555083.1| PREDICTED: cation/calcium exchanger 1-like [Glycine max] Length = 584 Score = 72.0 bits (175), Expect = 2e-12 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S + CT + K++D+ SKC YV+SN CR KGY+NYL+IFYC+ G+ P LG+ LL+ Sbjct: 62 SVDGCTDLHKYSDYDSKCLYVKSNVHCRSKGYINYLQIFYCSFGHSPILGHSLLV 116 >ref|XP_007029957.1| Sodium/potassium/calcium exchanger 6 precursor, putative [Theobroma cacao] gi|508718562|gb|EOY10459.1| Sodium/potassium/calcium exchanger 6 precursor, putative [Theobroma cacao] Length = 697 Score = 71.6 bits (174), Expect = 3e-12 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = +2 Query: 191 NSEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 ++ + C + + D+ ++C YV+S GCR KGY+NYL+IFYCTCG P LG+ +LL Sbjct: 56 SNSDGCAGLHDYTDYKTRCLYVKSEIGCRPKGYINYLQIFYCTCGRFPFLGHLVLL 111 >ref|XP_013451524.1| cation calcium exchanger [Medicago truncatula] gi|657381581|gb|KEH25552.1| cation calcium exchanger [Medicago truncatula] Length = 586 Score = 70.5 bits (171), Expect = 6e-12 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = +2 Query: 200 ENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 ++C+ + ++++TSKC YV+++S CR KGY+NYL+IFYC GN P LG+ LL+ Sbjct: 67 DSCSELHNYSNYTSKCIYVKTHSDCRSKGYINYLQIFYCNLGNSPILGHTLLV 119 >gb|KOM38603.1| hypothetical protein LR48_Vigan03g198500 [Vigna angularis] Length = 590 Score = 70.1 bits (170), Expect = 9e-12 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLL 355 S E CT + K++D SKC YVR+N CR KGY+NYL+IFYC G P G LL Sbjct: 65 SVEGCTDIHKYSDFDSKCLYVRTNLECRSKGYINYLQIFYCNSGKFPIFGQALL 118 >ref|XP_010054949.1| PREDICTED: cation/calcium exchanger 1 [Eucalyptus grandis] gi|629125503|gb|KCW89928.1| hypothetical protein EUGRSUZ_A02141 [Eucalyptus grandis] Length = 604 Score = 70.1 bits (170), Expect = 9e-12 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 + CT + + D+ +KC Y +S+ CR KGY+NYL+IFYCTCG P LG+ L L Sbjct: 72 TNNGCTSLDDYPDYKAKCAYAKSHDSCRHKGYINYLQIFYCTCGRFPVLGHVLFL 126 >ref|XP_007151476.1| hypothetical protein PHAVU_004G049800g [Phaseolus vulgaris] gi|561024785|gb|ESW23470.1| hypothetical protein PHAVU_004G049800g [Phaseolus vulgaris] Length = 579 Score = 69.3 bits (168), Expect = 2e-11 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S + CT + K+ D+ SKC YV+S+ CR KGY+NYL+IFYC+ G+ P LG+ LL+ Sbjct: 58 SVDGCTDLHKYLDNDSKCLYVKSHVHCRSKGYINYLQIFYCSFGHSPVLGHALLI 112 >emb|CBI31227.3| unnamed protein product [Vitis vinifera] Length = 519 Score = 68.9 bits (167), Expect = 2e-11 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S CT + + D+ +KC YV++ +GC GY+NYL IFYCTCG P+ GY +LL Sbjct: 70 SSGGCTGIHECTDYEAKCAYVKTQNGCLPNGYINYLHIFYCTCGRFPAWGYTVLL 124 >ref|XP_014495983.1| PREDICTED: cation/calcium exchanger 1-like [Vigna radiata var. radiata] Length = 580 Score = 68.9 bits (167), Expect = 2e-11 Identities = 28/55 (50%), Positives = 42/55 (76%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S + C+ + K+ D+ SKC YV+S++ CR KGY+NYL+IFYC+ G+ P LG+ LL+ Sbjct: 58 SVDGCSDLHKYLDNDSKCLYVKSHAQCRSKGYINYLQIFYCSFGHSPFLGHALLI 112 >ref|XP_002270512.2| PREDICTED: cation/calcium exchanger 1-like [Vitis vinifera] Length = 593 Score = 68.9 bits (167), Expect = 2e-11 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S CT + + D+ +KC YV++ +GC GY+NYL IFYCTCG P+ GY +LL Sbjct: 61 SSGGCTGIHECTDYEAKCAYVKTQNGCLPNGYINYLHIFYCTCGRFPAWGYTVLL 115 >ref|XP_004493218.1| PREDICTED: cation/calcium exchanger 1 [Cicer arietinum] Length = 606 Score = 68.9 bits (167), Expect = 2e-11 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLL 355 S + C + ++D+TSKC YV++ CR KGY+NYL+IFYC G P LG+ LL Sbjct: 67 SVDGCNDLHNYSDYTSKCSYVKTTLSCRSKGYINYLQIFYCNLGKFPFLGHSLL 120 >gb|KYP42949.1| Cation/calcium exchanger 4 [Cajanus cajan] Length = 531 Score = 68.6 bits (166), Expect = 3e-11 Identities = 28/55 (50%), Positives = 42/55 (76%) Frame = +2 Query: 194 SEENCTHVRKFADHTSKCEYVRSNSGCRGKGYLNYLEIFYCTCGNLPSLGYFLLL 358 S + C+ + K++D+ SKC YV+S+ CR KGY+NYL+IFYC+ G+ P LG+ LL+ Sbjct: 59 SVDGCSDLHKYSDYDSKCLYVKSHVQCRSKGYINYLQIFYCSFGHSPILGHALLV 113