BLASTX nr result
ID: Rehmannia27_contig00049961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00049961 (568 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070115.1| PREDICTED: vesicle-associated protein 1-4-li... 69 1e-10 >ref|XP_011070115.1| PREDICTED: vesicle-associated protein 1-4-like [Sesamum indicum] gi|747048230|ref|XP_011070116.1| PREDICTED: vesicle-associated protein 1-4-like [Sesamum indicum] Length = 354 Score = 68.9 bits (167), Expect = 1e-10 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 4/58 (6%) Frame = +1 Query: 70 YLMKQTLSLIWSLAMLAVMLIIKMIKEVLSDSVEDLIVK----ICMHLVFRLKDGMRL 231 YLMKQTLSLIWSLAM+ ML+ KMIK+++SDSVED IVK I MHL+F K+ + L Sbjct: 294 YLMKQTLSLIWSLAMVGTMLMFKMIKKLVSDSVEDWIVKTLLYIFMHLLFGRKENIHL 351