BLASTX nr result
ID: Rehmannia27_contig00049856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00049856 (736 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838442.1| PREDICTED: calcium-dependent protein kinase ... 125 1e-29 ref|XP_012854113.1| PREDICTED: calcium-dependent protein kinase ... 124 3e-29 ref|XP_011080420.1| PREDICTED: calcium-dependent protein kinase ... 123 7e-29 ref|XP_009627412.1| PREDICTED: calcium-dependent protein kinase ... 122 2e-28 ref|XP_009773532.1| PREDICTED: calcium-dependent protein kinase ... 122 2e-28 ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase ... 121 3e-28 gb|EPS70504.1| calcium dependent protein kinase 25 [Genlisea aurea] 121 3e-28 gb|AAZ76712.1| calcium-dependent protein kinase 1 [Petunia integ... 121 4e-28 ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase ... 121 4e-28 ref|XP_004252886.1| PREDICTED: calcium-dependent protein kinase ... 121 4e-28 ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase ... 121 4e-28 ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase ... 121 4e-28 ref|XP_009796949.1| PREDICTED: calcium-dependent protein kinase ... 121 4e-28 emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana p... 120 5e-28 ref|XP_015057806.1| PREDICTED: calcium-dependent protein kinase ... 119 2e-27 ref|XP_004250895.1| PREDICTED: calcium-dependent protein kinase ... 119 2e-27 ref|XP_004293141.1| PREDICTED: calcium-dependent protein kinase ... 119 2e-27 ref|XP_008786936.1| PREDICTED: calcium-dependent protein kinase ... 118 3e-27 ref|XP_010922091.1| PREDICTED: calcium-dependent protein kinase ... 118 4e-27 ref|XP_009368734.1| PREDICTED: calcium-dependent protein kinase ... 118 5e-27 >ref|XP_012838442.1| PREDICTED: calcium-dependent protein kinase 17-like [Erythranthe guttata] gi|604331089|gb|EYU35947.1| hypothetical protein MIMGU_mgv1a004350mg [Erythranthe guttata] Length = 532 Score = 125 bits (313), Expect = 1e-29 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMED+RATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED Sbjct: 59 MGPVLGRPMEDIRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 118 >ref|XP_012854113.1| PREDICTED: calcium-dependent protein kinase 34-like [Erythranthe guttata] gi|604348032|gb|EYU46187.1| hypothetical protein MIMGU_mgv1a004352mg [Erythranthe guttata] Length = 531 Score = 124 bits (311), Expect = 3e-29 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 VGPVLGRPMEDVR+TYT+GKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED Sbjct: 58 VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 117 >ref|XP_011080420.1| PREDICTED: calcium-dependent protein kinase 34-like [Sesamum indicum] Length = 532 Score = 123 bits (308), Expect = 7e-29 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 VGPVLGRPMEDVR+TYT+GKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKLANKEDIED Sbjct: 59 VGPVLGRPMEDVRSTYTMGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLANKEDIED 118 >ref|XP_009627412.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana tomentosiformis] Length = 541 Score = 122 bits (305), Expect = 2e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR TYTIGKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 68 IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED 127 >ref|XP_009773532.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana sylvestris] Length = 542 Score = 122 bits (305), Expect = 2e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR TYTIGKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 69 IGPVLGRPMEDVRTTYTIGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED 128 >ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase 17 [Solanum tuberosum] gi|723752803|ref|XP_010314698.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 [Solanum lycopersicum] gi|723752806|ref|XP_010314699.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 [Solanum lycopersicum] Length = 500 Score = 121 bits (303), Expect = 3e-28 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMED++ATYT+GKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 28 IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED 87 >gb|EPS70504.1| calcium dependent protein kinase 25 [Genlisea aurea] Length = 527 Score = 121 bits (303), Expect = 3e-28 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVRATYTIGKELGRGQFGVT+LCTHKQ+GE+FACKTIAKRKLANKEDIED Sbjct: 54 IGPVLGRPMEDVRATYTIGKELGRGQFGVTYLCTHKQTGEKFACKTIAKRKLANKEDIED 113 >gb|AAZ76712.1| calcium-dependent protein kinase 1 [Petunia integrifolia subsp. inflata] Length = 532 Score = 121 bits (303), Expect = 4e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR TY+IGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKL NKEDIED Sbjct: 59 IGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDIED 118 >ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana sylvestris] Length = 532 Score = 121 bits (303), Expect = 4e-28 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMED++ATYT+GKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 60 IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED 119 >ref|XP_004252886.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 [Solanum lycopersicum] gi|970068133|ref|XP_015061191.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum pennellii] Length = 535 Score = 121 bits (303), Expect = 4e-28 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMED++ATYT+GKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 63 IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED 122 >ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana tomentosiformis] Length = 536 Score = 121 bits (303), Expect = 4e-28 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMED++ATYT+GKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 64 IGPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIED 123 >ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana tomentosiformis] Length = 536 Score = 121 bits (303), Expect = 4e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR TY+IGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKL NKEDIED Sbjct: 64 IGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDIED 123 >ref|XP_009796949.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana sylvestris] Length = 537 Score = 121 bits (303), Expect = 4e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR TY+IGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKL NKEDIED Sbjct: 65 IGPVLGRPMEDVRKTYSIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLVNKEDIED 124 >emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana plumbaginifolia] Length = 534 Score = 120 bits (302), Expect = 5e-28 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR TY+IGKELGRGQFG+THLCTHKQSGEQFACKTIAKRKL NKEDIED Sbjct: 62 IGPVLGRPMEDVRKTYSIGKELGRGQFGITHLCTHKQSGEQFACKTIAKRKLVNKEDIED 121 >ref|XP_015057806.1| PREDICTED: calcium-dependent protein kinase 17 [Solanum pennellii] Length = 528 Score = 119 bits (297), Expect = 2e-27 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDV+ TY+IGKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 56 IGPVLGRPMEDVKKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDIED 115 >ref|XP_004250895.1| PREDICTED: calcium-dependent protein kinase 17-like [Solanum lycopersicum] Length = 529 Score = 119 bits (297), Expect = 2e-27 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDV+ TY+IGKELGRGQFGVTHLCTHKQ+GEQFACKTIAKRKL NKEDIED Sbjct: 57 IGPVLGRPMEDVKKTYSIGKELGRGQFGVTHLCTHKQNGEQFACKTIAKRKLVNKEDIED 116 >ref|XP_004293141.1| PREDICTED: calcium-dependent protein kinase 34 [Fragaria vesca subsp. vesca] Length = 531 Score = 119 bits (297), Expect = 2e-27 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR+TY+IGKELGRGQFGVTHLCTHKQ+GE FACKTIAKRKL NKEDIED Sbjct: 61 IGPVLGRPMEDVRSTYSIGKELGRGQFGVTHLCTHKQTGEHFACKTIAKRKLVNKEDIED 120 >ref|XP_008786936.1| PREDICTED: calcium-dependent protein kinase 34-like [Phoenix dactylifera] Length = 514 Score = 118 bits (296), Expect = 3e-27 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDV+ATY++GKELGRGQFGVTHLCTHK +GEQFACKTIAKRKLANKEDIED Sbjct: 45 IGPVLGRPMEDVKATYSMGKELGRGQFGVTHLCTHKLTGEQFACKTIAKRKLANKEDIED 104 >ref|XP_010922091.1| PREDICTED: calcium-dependent protein kinase 17-like [Elaeis guineensis] Length = 515 Score = 118 bits (295), Expect = 4e-27 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDV+ATYT+GKELGRGQFGVTHLCTH+ SGEQFACKTIAKRKL NKEDIED Sbjct: 46 IGPVLGRPMEDVKATYTMGKELGRGQFGVTHLCTHRISGEQFACKTIAKRKLVNKEDIED 105 >ref|XP_009368734.1| PREDICTED: calcium-dependent protein kinase 17-like [Pyrus x bretschneideri] Length = 534 Score = 118 bits (295), Expect = 5e-27 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = +1 Query: 556 VGPVLGRPMEDVRATYTIGKELGRGQFGVTHLCTHKQSGEQFACKTIAKRKLANKEDIED 735 +GPVLGRPMEDVR TY+IGKELGRGQFGVTHLCTHK +GEQFACKTIAKRKL NKEDIED Sbjct: 65 IGPVLGRPMEDVRTTYSIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNKEDIED 124