BLASTX nr result
ID: Rehmannia27_contig00049747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00049747 (665 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KUM45936.1| hypothetical protein ABT39_MTgene2039 (mitochondr... 67 1e-11 >gb|KUM45936.1| hypothetical protein ABT39_MTgene2039 (mitochondrion) [Picea glauca] Length = 71 Score = 67.4 bits (163), Expect = 1e-11 Identities = 35/65 (53%), Positives = 40/65 (61%) Frame = -2 Query: 316 GIGVDRWLGLSNDFSTGPAASRRGEARPVASMILDNPYNHRGSTYRTGITAKQDLDYLNH 137 G +D+W G+ F P VASMILDNPYNHR ST R GITAK+ LDY +H Sbjct: 17 GKALDKWTGIERCFLDWP----------VASMILDNPYNHRRSTDRAGITAKKHLDYRHH 66 Query: 136 WREII 122 WR II Sbjct: 67 WRGII 71