BLASTX nr result
ID: Rehmannia27_contig00048283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00048283 (638 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095751.1| PREDICTED: zinc transporter 1-like [Sesamum ... 59 5e-07 ref|XP_012841896.1| PREDICTED: zinc transporter 1 [Erythranthe g... 57 3e-06 >ref|XP_011095751.1| PREDICTED: zinc transporter 1-like [Sesamum indicum] Length = 361 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 2 ADFMNSRMENNVRLQLGSHISLLLGAGCMSF 94 ADFMN RM++NVRLQLG+HISLLLGAGCMSF Sbjct: 326 ADFMNPRMQSNVRLQLGAHISLLLGAGCMSF 356 >ref|XP_012841896.1| PREDICTED: zinc transporter 1 [Erythranthe guttata] gi|604328133|gb|EYU33801.1| hypothetical protein MIMGU_mgv1a008434mg [Erythranthe guttata] Length = 374 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 ADFMNSRMENNVRLQLGSHISLLLGAGCMSF 94 ADFMN RME N+RLQLG+H SLLLGAGCMSF Sbjct: 339 ADFMNPRMEGNLRLQLGAHTSLLLGAGCMSF 369