BLASTX nr result
ID: Rehmannia27_contig00048198
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00048198 (458 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087659.1| PREDICTED: chromatin structure-remodeling co... 54 9e-06 >ref|XP_011087659.1| PREDICTED: chromatin structure-remodeling complex protein BSH [Sesamum indicum] gi|747080795|ref|XP_011087660.1| PREDICTED: chromatin structure-remodeling complex protein BSH [Sesamum indicum] gi|747080797|ref|XP_011087662.1| PREDICTED: chromatin structure-remodeling complex protein BSH [Sesamum indicum] Length = 241 Score = 53.5 bits (127), Expect = 9e-06 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +3 Query: 3 SDPEEFAKSFCKDMGIEDPEVGVSIFNSLVLRMQYCDISMH*LT 134 SDPEEFAK+FCKDMGIEDPEVG +I ++ +R Q +I++ +T Sbjct: 126 SDPEEFAKTFCKDMGIEDPEVGPAI--AIAIREQLYEIAVQNVT 167