BLASTX nr result
ID: Rehmannia27_contig00046674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00046674 (430 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19108.1| hypothetical protein MIMGU_mgv1a006346mg [Erythra... 61 2e-08 ref|XP_012827628.1| PREDICTED: uncharacterized protein LOC105948... 61 2e-08 ref|XP_011096696.1| PREDICTED: uncharacterized protein LOC105175... 61 3e-08 >gb|EYU19108.1| hypothetical protein MIMGU_mgv1a006346mg [Erythranthe guttata] Length = 447 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 332 MPLPWKKVKSTRISQLVNDHLNISQKRRDGSSL 430 MP PWKKVKSTRISQ VNDHL+ SQ+RRDGSSL Sbjct: 1 MPFPWKKVKSTRISQFVNDHLHNSQRRRDGSSL 33 >ref|XP_012827628.1| PREDICTED: uncharacterized protein LOC105948911 [Erythranthe guttata] gi|848927903|ref|XP_012827629.1| PREDICTED: uncharacterized protein LOC105948911 [Erythranthe guttata] Length = 467 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 332 MPLPWKKVKSTRISQLVNDHLNISQKRRDGSSL 430 MP PWKKVKSTRISQ VNDHL+ SQ+RRDGSSL Sbjct: 1 MPFPWKKVKSTRISQFVNDHLHNSQRRRDGSSL 33 >ref|XP_011096696.1| PREDICTED: uncharacterized protein LOC105175802 [Sesamum indicum] Length = 477 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 332 MPLPWKKVKSTRISQLVNDHLNISQKRRDGSSL 430 M PWKKVKSTRISQLVNDHL+ SQKRRDGSSL Sbjct: 1 MAFPWKKVKSTRISQLVNDHLHNSQKRRDGSSL 33