BLASTX nr result
ID: Rehmannia27_contig00046186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00046186 (1040 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075959.1| PREDICTED: KH domain-containing protein At4g... 59 5e-06 >ref|XP_011075959.1| PREDICTED: KH domain-containing protein At4g18375 [Sesamum indicum] Length = 669 Score = 58.9 bits (141), Expect = 5e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 1040 IETKTHIRVLPRDQTLPRCVAMSEEIVQVL 951 IETKTHIR+LPRD TLPRCVAMSEEIVQV+ Sbjct: 220 IETKTHIRILPRDHTLPRCVAMSEEIVQVV 249