BLASTX nr result
ID: Rehmannia27_contig00044961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044961 (909 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097923.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-06 ref|XP_012841723.1| PREDICTED: pentatricopeptide repeat-containi... 58 8e-06 >ref|XP_011097923.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Sesamum indicum] Length = 904 Score = 58.5 bits (140), Expect = 5e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 3 ALNVVDEVFKSGIALSLETFHSILDACYTSCEFNLVCQ 116 AL VV E FKSG+ALS+E FHSILDAC SCEFNLV Q Sbjct: 468 ALYVVAEAFKSGVALSIEIFHSILDACDQSCEFNLVHQ 505 >ref|XP_012841723.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21880, mitochondrial-like [Erythranthe guttata] Length = 905 Score = 57.8 bits (138), Expect = 8e-06 Identities = 30/38 (78%), Positives = 30/38 (78%) Frame = +3 Query: 3 ALNVVDEVFKSGIALSLETFHSILDACYTSCEFNLVCQ 116 ALNVVDE FK GI LSLETFH ILDAC S EFNLV Q Sbjct: 460 ALNVVDEAFKFGITLSLETFHLILDACDQSYEFNLVNQ 497