BLASTX nr result
ID: Rehmannia27_contig00044686
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044686 (639 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00224.1| unnamed protein product [Coffea canephora] 54 1e-06 >emb|CDP00224.1| unnamed protein product [Coffea canephora] Length = 83 Score = 54.3 bits (129), Expect = 1e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 6/48 (12%) Frame = +2 Query: 155 LIENPWGGSHPTT------KSERLGGPSPKLSARVSQKFERTKEVASA 280 L ENPW ++ + +RLGGPSPKLS +VS+KFERTKEVASA Sbjct: 7 LPENPWSAANQNKAPKSPRQPKRLGGPSPKLSRKVSEKFERTKEVASA 54