BLASTX nr result
ID: Rehmannia27_contig00044681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044681 (671 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090543.1| PREDICTED: cyclin-dependent kinase C-1 [Sesa... 128 5e-31 ref|XP_012845335.1| PREDICTED: cyclin-dependent kinase C-1 [Eryt... 118 2e-27 ref|XP_009627964.1| PREDICTED: cyclin-dependent kinase C-1-like ... 98 3e-20 ref|XP_009792780.1| PREDICTED: cyclin-dependent kinase C-1-like ... 97 1e-19 ref|XP_010319696.1| PREDICTED: cyclin dependent kinase C isoform... 96 1e-19 ref|XP_006355337.1| PREDICTED: cyclin-dependent kinase C-1-like ... 96 1e-19 ref|NP_001234799.1| cyclin dependent kinase C [Solanum lycopersi... 96 1e-19 ref|XP_015071461.1| PREDICTED: cyclin-dependent kinase C-1-like ... 96 1e-19 ref|XP_010319695.1| PREDICTED: cyclin dependent kinase C isoform... 96 1e-19 emb|CDP01460.1| unnamed protein product [Coffea canephora] 85 1e-15 gb|KDO56558.1| hypothetical protein CISIN_1g011627mg [Citrus sin... 84 3e-15 gb|KDO56557.1| hypothetical protein CISIN_1g011627mg [Citrus sin... 84 3e-15 ref|XP_006464241.1| PREDICTED: cyclin-dependent kinase C-1 isofo... 84 3e-15 gb|KDO56556.1| hypothetical protein CISIN_1g011627mg [Citrus sin... 84 3e-15 ref|XP_006428202.1| hypothetical protein CICLE_v10025386mg [Citr... 84 4e-15 ref|XP_015890635.1| PREDICTED: cyclin-dependent kinase C-1 [Zizi... 81 3e-14 ref|XP_008802214.1| PREDICTED: cyclin-dependent kinase C-2 [Phoe... 80 6e-14 ref|XP_010243830.1| PREDICTED: cyclin-dependent kinase C-2-like ... 80 8e-14 ref|XP_002439737.1| hypothetical protein SORBIDRAFT_09g019250 [S... 79 1e-13 ref|XP_015886645.1| PREDICTED: cyclin-dependent kinase C-2-like ... 78 3e-13 >ref|XP_011090543.1| PREDICTED: cyclin-dependent kinase C-1 [Sesamum indicum] Length = 512 Score = 128 bits (321), Expect = 5e-31 Identities = 56/67 (83%), Positives = 59/67 (88%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSGGR 401 QDRGGQSGGYNSGP+P QGR PP YPGN+APSN PRG GGYGAPPN+SQSGQYGVSGGR Sbjct: 436 QDRGGQSGGYNSGPFPPQGRGPPLYPGNSAPSNAPRGTGGGYGAPPNYSQSGQYGVSGGR 495 Query: 400 GSNPVGG 380 G NP GG Sbjct: 496 GPNPQGG 502 >ref|XP_012845335.1| PREDICTED: cyclin-dependent kinase C-1 [Erythranthe guttata] gi|604319842|gb|EYU31006.1| hypothetical protein MIMGU_mgv1a004642mg [Erythranthe guttata] Length = 517 Score = 118 bits (296), Expect = 2e-27 Identities = 55/75 (73%), Positives = 59/75 (78%), Gaps = 8/75 (10%) Frame = -2 Query: 580 QDRGGQ--------SGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSG 425 QDRGGQ SG Y+SGPYPSQGR PP YPGN+APSNGPRG GGY APPN++QSG Sbjct: 433 QDRGGQGQSQSQSQSGAYSSGPYPSQGRGPPPYPGNSAPSNGPRGTGGGYVAPPNYTQSG 492 Query: 424 QYGVSGGRGSNPVGG 380 QYGVSGGRG NP GG Sbjct: 493 QYGVSGGRGQNPPGG 507 >ref|XP_009627964.1| PREDICTED: cyclin-dependent kinase C-1-like [Nicotiana tomentosiformis] Length = 509 Score = 98.2 bits (243), Expect = 3e-20 Identities = 46/68 (67%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 404 QDRG Q GGY+SG YP QGR PP YPG+ S+GPRG +GGYG PP++SQSGQYG SG G Sbjct: 433 QDRGAQGGGYSSGTYPPQGRAPP-YPGSGVASSGPRGPSGGYGVPPSYSQSGQYGGSGAG 491 Query: 403 RGSNPVGG 380 RGSN + G Sbjct: 492 RGSNQMSG 499 >ref|XP_009792780.1| PREDICTED: cyclin-dependent kinase C-1-like [Nicotiana sylvestris] gi|662552169|gb|AIE54287.1| cyclin dependent kinase C [Nicotiana tabacum] Length = 508 Score = 96.7 bits (239), Expect = 1e-19 Identities = 46/68 (67%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 404 QDRG Q GGY+SG YP QGR PP YPG+ S+ PRG +GGYG PPN+SQSGQYG SG G Sbjct: 432 QDRGAQGGGYSSGTYPPQGRAPP-YPGSGVASSVPRGPSGGYGVPPNYSQSGQYGGSGTG 490 Query: 403 RGSNPVGG 380 RGSN + G Sbjct: 491 RGSNQMSG 498 >ref|XP_010319696.1| PREDICTED: cyclin dependent kinase C isoform X2 [Solanum lycopersicum] Length = 472 Score = 96.3 bits (238), Expect = 1e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 404 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 396 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 454 Query: 403 RGSNPVGG 380 RGSN + G Sbjct: 455 RGSNQMSG 462 >ref|XP_006355337.1| PREDICTED: cyclin-dependent kinase C-1-like [Solanum tuberosum] Length = 512 Score = 96.3 bits (238), Expect = 1e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 404 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 436 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 494 Query: 403 RGSNPVGG 380 RGSN + G Sbjct: 495 RGSNQMSG 502 >ref|NP_001234799.1| cyclin dependent kinase C [Solanum lycopersicum] gi|970020461|ref|XP_015071462.1| PREDICTED: cyclin-dependent kinase C-1-like isoform X2 [Solanum pennellii] gi|15215944|emb|CAC51391.1| cyclin dependent kinase C [Solanum lycopersicum] Length = 512 Score = 96.3 bits (238), Expect = 1e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 404 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 436 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 494 Query: 403 RGSNPVGG 380 RGSN + G Sbjct: 495 RGSNQMSG 502 >ref|XP_015071461.1| PREDICTED: cyclin-dependent kinase C-1-like isoform X1 [Solanum pennellii] Length = 543 Score = 96.3 bits (238), Expect = 1e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 404 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 467 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 525 Query: 403 RGSNPVGG 380 RGSN + G Sbjct: 526 RGSNQMSG 533 >ref|XP_010319695.1| PREDICTED: cyclin dependent kinase C isoform X1 [Solanum lycopersicum] Length = 543 Score = 96.3 bits (238), Expect = 1e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 404 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 467 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 525 Query: 403 RGSNPVGG 380 RGSN + G Sbjct: 526 RGSNQMSG 533 >emb|CDP01460.1| unnamed protein product [Coffea canephora] Length = 512 Score = 84.7 bits (208), Expect = 1e-15 Identities = 40/66 (60%), Positives = 45/66 (68%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSGGRG 398 DRGGQ G Y SG YP+QGR PP YPG++ P RG A GYGAPPN+SQS QYG SG Sbjct: 438 DRGGQGGSYGSGAYPAQGRGPP-YPGSSLPPAAQRGAASGYGAPPNYSQSNQYGGSGAGR 496 Query: 397 SNPVGG 380 N + G Sbjct: 497 PNSMAG 502 >gb|KDO56558.1| hypothetical protein CISIN_1g011627mg [Citrus sinensis] Length = 417 Score = 83.6 bits (205), Expect = 3e-15 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVS-GG 404 +RGGQ GGY++ PYP QGR PP Y G P+NGPRG A GYG P ++SQSGQYG S G Sbjct: 341 NRGGQGGGYSNAPYPPQGRGPP-YAGAGMPANGPRGPASGYGVGPQSYSQSGQYGNSAAG 399 Query: 403 RGSNPVGG 380 RG N +GG Sbjct: 400 RGPNQMGG 407 >gb|KDO56557.1| hypothetical protein CISIN_1g011627mg [Citrus sinensis] Length = 472 Score = 83.6 bits (205), Expect = 3e-15 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVS-GG 404 +RGGQ GGY++ PYP QGR PP Y G P+NGPRG A GYG P ++SQSGQYG S G Sbjct: 396 NRGGQGGGYSNAPYPPQGRGPP-YAGAGMPANGPRGPASGYGVGPQSYSQSGQYGNSAAG 454 Query: 403 RGSNPVGG 380 RG N +GG Sbjct: 455 RGPNQMGG 462 >ref|XP_006464241.1| PREDICTED: cyclin-dependent kinase C-1 isoform X2 [Citrus sinensis] Length = 472 Score = 83.6 bits (205), Expect = 3e-15 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVS-GG 404 +RGGQ GGY++ PYP QGR PP Y G P+NGPRG A GYG P ++SQSGQYG S G Sbjct: 396 NRGGQGGGYSNAPYPPQGRGPP-YAGAGMPANGPRGPASGYGVGPQSYSQSGQYGNSAAG 454 Query: 403 RGSNPVGG 380 RG N +GG Sbjct: 455 RGPNQMGG 462 >gb|KDO56556.1| hypothetical protein CISIN_1g011627mg [Citrus sinensis] Length = 481 Score = 83.6 bits (205), Expect = 3e-15 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVS-GG 404 +RGGQ GGY++ PYP QGR PP Y G P+NGPRG A GYG P ++SQSGQYG S G Sbjct: 405 NRGGQGGGYSNAPYPPQGRGPP-YAGAGMPANGPRGPASGYGVGPQSYSQSGQYGNSAAG 463 Query: 403 RGSNPVGG 380 RG N +GG Sbjct: 464 RGPNQMGG 471 >ref|XP_006428202.1| hypothetical protein CICLE_v10025386mg [Citrus clementina] gi|568819398|ref|XP_006464240.1| PREDICTED: cyclin-dependent kinase C-1 isoform X1 [Citrus sinensis] gi|557530192|gb|ESR41442.1| hypothetical protein CICLE_v10025386mg [Citrus clementina] Length = 513 Score = 83.6 bits (205), Expect = 4e-15 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVS-GG 404 +RGGQ GGY++ PYP QGR PP Y G P+NGPRG A GYG P ++SQSGQYG S G Sbjct: 437 NRGGQGGGYSNAPYPPQGRGPP-YAGAGMPANGPRGPASGYGVGPQSYSQSGQYGNSAAG 495 Query: 403 RGSNPVGG 380 RG N +GG Sbjct: 496 RGPNQMGG 503 >ref|XP_015890635.1| PREDICTED: cyclin-dependent kinase C-1 [Ziziphus jujuba] Length = 513 Score = 80.9 bits (198), Expect = 3e-14 Identities = 41/68 (60%), Positives = 48/68 (70%), Gaps = 2/68 (2%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVS-GG 404 +RG Q+GGY+ YP+QGR PP Y G+ P GPRG GYG PPN+SQS QYG S GG Sbjct: 437 NRGAQAGGYSGSQYPAQGRGPP-YGGSGMPVPGPRGAPTGYGVGPPNYSQSNQYGGSAGG 495 Query: 403 RGSNPVGG 380 RG NP+GG Sbjct: 496 RGPNPLGG 503 >ref|XP_008802214.1| PREDICTED: cyclin-dependent kinase C-2 [Phoenix dactylifera] Length = 521 Score = 80.1 bits (196), Expect = 6e-14 Identities = 41/70 (58%), Positives = 47/70 (67%), Gaps = 4/70 (5%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAP-SNGPRGNAG-GYG-APPNFSQSGQYGVSG 407 +RGGQ GGY GPYP QGR PP Y G+ P + GPRG +G GYG PN+ Q G YG SG Sbjct: 438 NRGGQGGGYGGGPYPQQGRGPPPYGGSGMPGTGGPRGGSGSGYGVGAPNYPQGGPYGASG 497 Query: 406 -GRGSNPVGG 380 GRG N +GG Sbjct: 498 AGRGPNMMGG 507 >ref|XP_010243830.1| PREDICTED: cyclin-dependent kinase C-2-like [Nelumbo nucifera] gi|720086413|ref|XP_010243831.1| PREDICTED: cyclin-dependent kinase C-2-like [Nelumbo nucifera] Length = 514 Score = 79.7 bits (195), Expect = 8e-14 Identities = 40/68 (58%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = -2 Query: 577 DRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVSG-G 404 +RGGQ GGY+ GPYP QGR PP Y + P GPRG + GYG PN+ Q G YG SG G Sbjct: 438 NRGGQGGGYSGGPYPPQGRGPP-YAASAMPGAGPRGGSSGYGVGAPNYPQGGPYGGSGVG 496 Query: 403 RGSNPVGG 380 RGSN +GG Sbjct: 497 RGSNMMGG 504 >ref|XP_002439737.1| hypothetical protein SORBIDRAFT_09g019250 [Sorghum bicolor] gi|241945022|gb|EES18167.1| hypothetical protein SORBI_009G125000 [Sorghum bicolor] Length = 516 Score = 79.0 bits (193), Expect = 1e-13 Identities = 42/67 (62%), Positives = 46/67 (68%), Gaps = 4/67 (5%) Frame = -2 Query: 580 QDRGGQSGGYNSGPYPSQGRVPPSYPGNN-APSNGPR-GNAGGYG-APPNFSQSGQYGVS 410 Q+RGGQ GGY+SG YP QGR PP YPG + GPR GN GYG PN+ Q G YGVS Sbjct: 433 QNRGGQGGGYSSGSYPQQGRGPPPYPGGGMGGTGGPRGGNGSGYGVGRPNYQQVGPYGVS 492 Query: 409 G-GRGSN 392 G GRGSN Sbjct: 493 GPGRGSN 499 >ref|XP_015886645.1| PREDICTED: cyclin-dependent kinase C-2-like [Ziziphus jujuba] gi|1009138553|ref|XP_015886646.1| PREDICTED: cyclin-dependent kinase C-2-like [Ziziphus jujuba] gi|1009138555|ref|XP_015886647.1| PREDICTED: cyclin-dependent kinase C-2-like [Ziziphus jujuba] Length = 516 Score = 78.2 bits (191), Expect = 3e-13 Identities = 45/71 (63%), Positives = 49/71 (69%), Gaps = 5/71 (7%) Frame = -2 Query: 577 DRGGQSGG--YNSGPYPSQGRVPPSYPGNNAPSNGPRGNAG-GYG-APPNFSQSGQYGVS 410 +RGGQ GG YNSGPYPSQGR P Y + PS GPRG G GYG PN+SQSG YG S Sbjct: 437 NRGGQGGGGGYNSGPYPSQGRGAP-YGSTSIPSGGPRGGGGSGYGVGGPNYSQSGPYGSS 495 Query: 409 -GGRGSNPVGG 380 GRGSN +GG Sbjct: 496 AAGRGSNMMGG 506