BLASTX nr result
ID: Rehmannia27_contig00044663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044663 (378 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084722.1| PREDICTED: uncharacterized protein LOC105166... 56 1e-06 >ref|XP_011084722.1| PREDICTED: uncharacterized protein LOC105166900 [Sesamum indicum] Length = 861 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 376 EPPPEFKCPISGILMKDPVVLASGQVRLCSFFWTWI 269 EPPPEF+CPISG+LMKDPVVLASGQ + W+ Sbjct: 71 EPPPEFRCPISGLLMKDPVVLASGQTYEEQYITEWL 106