BLASTX nr result
ID: Rehmannia27_contig00042884
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00042884 (657 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35618.1| hypothetical protein MIMGU_mgv1a017467mg [Erythra... 62 2e-09 ref|XP_011070402.1| PREDICTED: uncharacterized protein LOC105156... 61 4e-09 >gb|EYU35618.1| hypothetical protein MIMGU_mgv1a017467mg [Erythranthe guttata] Length = 73 Score = 61.6 bits (148), Expect = 2e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 403 NPCINQGKSMNSWAGSLEKGKFAPKFDGLRFIETLVTAHR 284 N C QGKS+NS S EKGKFAPK+DGL+FIETL+TAHR Sbjct: 34 NSCTYQGKSVNSPPISSEKGKFAPKYDGLKFIETLITAHR 73 >ref|XP_011070402.1| PREDICTED: uncharacterized protein LOC105156067 [Sesamum indicum] Length = 77 Score = 60.8 bits (146), Expect = 4e-09 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -3 Query: 403 NPCINQ-GKSMNSWAGSLEKGKFAPKFDGLRFIETLVTAHR 284 NP I Q GKSM++ A S EKGKFAP FDGLRFIETL+TAHR Sbjct: 37 NPSITQKGKSMSAGAPSPEKGKFAPNFDGLRFIETLITAHR 77