BLASTX nr result
ID: Rehmannia27_contig00042735
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00042735 (779 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF30423.1| conserved hypothetical protein [Ricinus communis] 70 2e-10 >gb|EEF30423.1| conserved hypothetical protein [Ricinus communis] Length = 353 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 589 AKWQIRNLVSTRHREWPMFQEPMLPIRSEPTTERMPAAE 473 AKWQIRNL STRHREWPMFQEPMLPI+S PT E MP + Sbjct: 296 AKWQIRNLESTRHREWPMFQEPMLPIQSIPTIETMPTVD 334