BLASTX nr result
ID: Rehmannia27_contig00042730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00042730 (378 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 47 5e-07 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 47.4 bits (111), Expect(2) = 5e-07 Identities = 24/67 (35%), Positives = 40/67 (59%) Frame = +3 Query: 177 QGNRIHATIRKMHMEQHKKLLIEGRIYAIRDFLVTNQTDKYKTCETKYKIIFHGKTHMFE 356 +G +H I K +E++ +L G++Y+IR+FLV + YKT KY + F+ KT + E Sbjct: 50 EGTVLHVNIPKEFVEKYSAMLKIGQVYSIRNFLVISNFYTYKTSPHKYMLKFYYKTVVRE 109 Query: 357 MFDKSYP 377 + D +P Sbjct: 110 LKDIVFP 116 Score = 33.1 bits (74), Expect(2) = 5e-07 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 1 AIKVRLVRMYKKSAFNDNTQITSLECIFHDSE 96 AIKVRL+R Y+ I ECIFHD E Sbjct: 19 AIKVRLIRSYEVPERRGAASIKCQECIFHDKE 50