BLASTX nr result
ID: Rehmannia27_contig00042685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00042685 (381 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088330.1| hypothetical protein L484_005845 [Morus nota... 47 2e-08 >ref|XP_010088330.1| hypothetical protein L484_005845 [Morus notabilis] gi|587843376|gb|EXB33946.1| hypothetical protein L484_005845 [Morus notabilis] Length = 112 Score = 47.0 bits (110), Expect(2) = 2e-08 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +1 Query: 1 ELLRNNGLKEADSRSLDQPMTEKK--RSSSLFFTYTDREK 114 ELLRNN LKEADSRSLDQPMTE+K R S F++T EK Sbjct: 40 ELLRNNRLKEADSRSLDQPMTEQKWVRHS---FSHTPGEK 76 Score = 38.5 bits (88), Expect(2) = 2e-08 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +3 Query: 99 HRPGEKVTIXXXXXXXXXXXXXXXXXXXTLEIHIDQLISASC 224 H PGEKVTI TLEIHIDQ ISASC Sbjct: 71 HTPGEKVTIASSSPAGEPPGQGGGGQPSTLEIHIDQSISASC 112