BLASTX nr result
ID: Rehmannia27_contig00042413
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00042413 (523 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096305.1| PREDICTED: callose synthase 11-like [Sesamum... 64 7e-09 ref|XP_012848713.1| PREDICTED: callose synthase 11-like [Erythra... 63 2e-08 ref|XP_004294021.1| PREDICTED: callose synthase 11 [Fragaria ves... 59 5e-07 ref|XP_010097906.1| Callose synthase 12 [Morus notabilis] gi|587... 58 7e-07 ref|XP_010274605.1| PREDICTED: callose synthase 12-like [Nelumbo... 58 1e-06 ref|XP_015867882.1| PREDICTED: callose synthase 12-like [Ziziphu... 57 2e-06 ref|XP_015871227.1| PREDICTED: callose synthase 12-like [Ziziphu... 57 2e-06 ref|XP_015870874.1| PREDICTED: callose synthase 12-like [Ziziphu... 57 2e-06 ref|XP_015870843.1| PREDICTED: callose synthase 12-like [Ziziphu... 57 2e-06 ref|XP_007198904.1| hypothetical protein PRUPE_ppa000167m1g, par... 57 2e-06 ref|XP_006447310.1| hypothetical protein CICLE_v10018223mg, part... 57 2e-06 ref|XP_004305416.1| PREDICTED: callose synthase 12 [Fragaria ves... 57 2e-06 ref|XP_009357876.1| PREDICTED: callose synthase 12-like [Pyrus x... 57 2e-06 ref|XP_009357857.1| PREDICTED: callose synthase 12-like [Pyrus x... 57 2e-06 ref|XP_008229065.1| PREDICTED: callose synthase 12 [Prunus mume] 57 2e-06 gb|KDO51558.1| hypothetical protein CISIN_1g000259mg [Citrus sin... 57 2e-06 ref|XP_006491624.1| PREDICTED: callose synthase 12 [Citrus sinen... 57 2e-06 gb|KRH25578.1| hypothetical protein GLYMA_12G1133002, partial [G... 56 3e-06 ref|XP_014620157.1| PREDICTED: callose synthase 12-like [Glycine... 56 3e-06 ref|XP_014493833.1| PREDICTED: callose synthase 12 [Vigna radiat... 56 3e-06 >ref|XP_011096305.1| PREDICTED: callose synthase 11-like [Sesamum indicum] Length = 1777 Score = 63.9 bits (154), Expect = 7e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 434 LLSEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 +LSEPFNIIPIHNLLTDHPSLRYPEVRAAA Sbjct: 26 MLSEPFNIIPIHNLLTDHPSLRYPEVRAAA 55 >ref|XP_012848713.1| PREDICTED: callose synthase 11-like [Erythranthe guttata] gi|604315264|gb|EYU27970.1| hypothetical protein MIMGU_mgv1a000106mg [Erythranthe guttata] Length = 1776 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 434 LLSEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 LLSEPFNIIPIHNLL DHPSLRYPEVRAAA Sbjct: 26 LLSEPFNIIPIHNLLADHPSLRYPEVRAAA 55 >ref|XP_004294021.1| PREDICTED: callose synthase 11 [Fragaria vesca subsp. vesca] Length = 1767 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 437 LSEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 + EPFNIIPIHNLL DHPSLRYPE+RAAA Sbjct: 20 MQEPFNIIPIHNLLADHPSLRYPEIRAAA 48 >ref|XP_010097906.1| Callose synthase 12 [Morus notabilis] gi|587884063|gb|EXB72969.1| Callose synthase 12 [Morus notabilis] Length = 1774 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 SEP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 24 SEPYNIIPVHNLLADHPSLRYPEVRAAA 51 >ref|XP_010274605.1| PREDICTED: callose synthase 12-like [Nelumbo nucifera] Length = 1781 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 443 EPFNIIPIHNLLTDHPSLRYPEVRAAA 523 EPFNIIP+HNLL DHPSLRYPEVRAAA Sbjct: 35 EPFNIIPVHNLLADHPSLRYPEVRAAA 61 >ref|XP_015867882.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] Length = 1320 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 +EP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 24 TEPYNIIPVHNLLADHPSLRYPEVRAAA 51 >ref|XP_015871227.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] Length = 1773 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 +EP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 24 TEPYNIIPVHNLLADHPSLRYPEVRAAA 51 >ref|XP_015870874.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] gi|1009179061|ref|XP_015870875.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] gi|1009179178|ref|XP_015870940.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] gi|1009179180|ref|XP_015870942.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] Length = 1773 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 +EP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 24 TEPYNIIPVHNLLADHPSLRYPEVRAAA 51 >ref|XP_015870843.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] gi|1009179006|ref|XP_015870844.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] gi|1009179008|ref|XP_015870845.1| PREDICTED: callose synthase 12-like [Ziziphus jujuba] Length = 1773 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 +EP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 24 TEPYNIIPVHNLLADHPSLRYPEVRAAA 51 >ref|XP_007198904.1| hypothetical protein PRUPE_ppa000167m1g, partial [Prunus persica] gi|462394199|gb|EMJ00103.1| hypothetical protein PRUPE_ppa000167m1g, partial [Prunus persica] Length = 633 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 SEP+NIIP+HNLL DHPSLR+PEVRAAA Sbjct: 16 SEPYNIIPVHNLLADHPSLRFPEVRAAA 43 >ref|XP_006447310.1| hypothetical protein CICLE_v10018223mg, partial [Citrus clementina] gi|557549921|gb|ESR60550.1| hypothetical protein CICLE_v10018223mg, partial [Citrus clementina] Length = 1527 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 443 EPFNIIPIHNLLTDHPSLRYPEVRAAA 523 EP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 10 EPYNIIPVHNLLADHPSLRYPEVRAAA 36 >ref|XP_004305416.1| PREDICTED: callose synthase 12 [Fragaria vesca subsp. vesca] Length = 1758 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 SEP+NIIP+HNLL DHPSLR+PEVRAAA Sbjct: 10 SEPYNIIPVHNLLADHPSLRFPEVRAAA 37 >ref|XP_009357876.1| PREDICTED: callose synthase 12-like [Pyrus x bretschneideri] Length = 1769 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 SEP+NIIP+HNLL DHPSLR+PEVRAAA Sbjct: 16 SEPYNIIPVHNLLADHPSLRFPEVRAAA 43 >ref|XP_009357857.1| PREDICTED: callose synthase 12-like [Pyrus x bretschneideri] Length = 1769 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 SEP+NIIP+HNLL DHPSLR+PEVRAAA Sbjct: 16 SEPYNIIPVHNLLADHPSLRFPEVRAAA 43 >ref|XP_008229065.1| PREDICTED: callose synthase 12 [Prunus mume] Length = 1769 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 440 SEPFNIIPIHNLLTDHPSLRYPEVRAAA 523 SEP+NIIP+HNLL DHPSLR+PEVRAAA Sbjct: 16 SEPYNIIPVHNLLADHPSLRFPEVRAAA 43 >gb|KDO51558.1| hypothetical protein CISIN_1g000259mg [Citrus sinensis] Length = 1771 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 443 EPFNIIPIHNLLTDHPSLRYPEVRAAA 523 EP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 24 EPYNIIPVHNLLADHPSLRYPEVRAAA 50 >ref|XP_006491624.1| PREDICTED: callose synthase 12 [Citrus sinensis] Length = 1771 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 443 EPFNIIPIHNLLTDHPSLRYPEVRAAA 523 EP+NIIP+HNLL DHPSLRYPEVRAAA Sbjct: 24 EPYNIIPVHNLLADHPSLRYPEVRAAA 50 >gb|KRH25578.1| hypothetical protein GLYMA_12G1133002, partial [Glycine max] Length = 483 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 443 EPFNIIPIHNLLTDHPSLRYPEVRAAA 523 EPFNIIP+HNLL DHPSLR+PEVRAAA Sbjct: 22 EPFNIIPVHNLLADHPSLRFPEVRAAA 48 >ref|XP_014620157.1| PREDICTED: callose synthase 12-like [Glycine max] Length = 826 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 443 EPFNIIPIHNLLTDHPSLRYPEVRAAA 523 EPFNIIP+HNLL DHPSLR+PEVRAAA Sbjct: 22 EPFNIIPVHNLLADHPSLRFPEVRAAA 48 >ref|XP_014493833.1| PREDICTED: callose synthase 12 [Vigna radiata var. radiata] Length = 1769 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +2 Query: 443 EPFNIIPIHNLLTDHPSLRYPEVRAA 520 EPFNIIP+HNLLTDHPSLR+PEVRAA Sbjct: 21 EPFNIIPLHNLLTDHPSLRFPEVRAA 46