BLASTX nr result
ID: Rehmannia27_contig00042237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00042237 (883 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856133.1| PREDICTED: probable 2-oxoglutarate-dependent... 77 1e-12 emb|CDO98088.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_012852631.1| PREDICTED: probable 2-oxoglutarate-dependent... 62 1e-07 ref|NP_175688.1| oxidoreductase, 2OG-Fe(II) oxygenase family pro... 59 1e-06 emb|CAN80139.1| hypothetical protein VITISV_028513 [Vitis vinifera] 59 2e-06 ref|XP_002284974.1| PREDICTED: probable 2-oxoglutarate-dependent... 59 2e-06 gb|KDO58205.1| hypothetical protein CISIN_1g045288mg [Citrus sin... 56 8e-06 ref|XP_009802367.1| PREDICTED: 2-oxoglutarate-dependent dioxygen... 57 1e-05 >ref|XP_012856133.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 [Erythranthe guttata] gi|604301995|gb|EYU21581.1| hypothetical protein MIMGU_mgv1a010326mg [Erythranthe guttata] Length = 316 Score = 76.6 bits (187), Expect = 1e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -1 Query: 145 ETIYSYCKLLLELDNTVMKMVTSSYNLEKYYDPLIQSSTYLTRMMKYH 2 ETIYSYCKLL EL+ TV+KMV SY LEKYYDPL++SS Y+TR+M+Y+ Sbjct: 131 ETIYSYCKLLSELNKTVVKMVADSYGLEKYYDPLMESSFYMTRLMRYN 178 >emb|CDO98088.1| unnamed protein product [Coffea canephora] Length = 315 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -1 Query: 145 ETIYSYCKLLLELDNTVMKMVTSSYNLEKYYDPLIQSSTYLTRMMKY 5 ET +SY KLL ELD+ VM+MV SY +EKY DPLI+SS YL R +KY Sbjct: 128 ETAFSYSKLLSELDHGVMRMVFGSYGVEKYLDPLIKSSFYLMRFLKY 174 >ref|XP_012852631.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 [Erythranthe guttata] gi|604305533|gb|EYU24677.1| hypothetical protein MIMGU_mgv1a010266mg [Erythranthe guttata] Length = 317 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -1 Query: 145 ETIYSYCKLLLELDNTVMKMVTSSYNL-EKYYDPLIQSSTYLTRMMKY 5 ETI+SY LL EL NTVMKMV SSY L +KYYD L+ SS Y+TR+++Y Sbjct: 128 ETIHSYSNLLSELHNTVMKMVVSSYGLDDKYYDNLVDSSLYMTRLIEY 175 >ref|NP_175688.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gi|12324652|gb|AAG52288.1|AC019018_25 putative oxidoreductase; 32373-31266 [Arabidopsis thaliana] gi|332194731|gb|AEE32852.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] Length = 310 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -1 Query: 148 SETIYSYCKLLLELDNTVMKMVTSSYNLEKYYDPLIQSSTYLTRMMK 8 SE +Y Y + ELD V +MV SYN+EKYYDP I+S+TYL R++K Sbjct: 122 SECLYKYAEFAAELDQMVTRMVFQSYNVEKYYDPYIESTTYLLRVLK 168 >emb|CAN80139.1| hypothetical protein VITISV_028513 [Vitis vinifera] Length = 311 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -1 Query: 145 ETIYSYCKLLLELDNTVMKMVTSSYNLEKYYDPLIQSSTYLTRMMKY 5 ET+ SY KL+ EL+ V KMV SY+ EKYYD IQS+TYL R++KY Sbjct: 125 ETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKY 171 >ref|XP_002284974.1| PREDICTED: probable 2-oxoglutarate-dependent dioxygenase AOP1 [Vitis vinifera] gi|297743336|emb|CBI36203.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -1 Query: 145 ETIYSYCKLLLELDNTVMKMVTSSYNLEKYYDPLIQSSTYLTRMMKY 5 ET+ SY KL+ EL+ V KMV SY+ EKYYD IQS+TYL R++KY Sbjct: 125 ETVLSYSKLVSELEQMVKKMVFESYDAEKYYDSHIQSTTYLLRLIKY 171 >gb|KDO58205.1| hypothetical protein CISIN_1g045288mg [Citrus sinensis] Length = 236 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = -1 Query: 145 ETIYSYCKLLLELDNTVMKMVTSSYNLEKYYDPLIQSSTYLTRMMKY 5 +T+ SY +L+ EL+ V +MV SY ++KYYD +++SSTYL R+MKY Sbjct: 127 KTVVSYSRLVSELEQMVKRMVFESYGVDKYYDSVLESSTYLLRIMKY 173 >ref|XP_009802367.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase AOP3-like [Nicotiana sylvestris] Length = 313 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -1 Query: 145 ETIYSYCKLLLELDNTVMKMVTSSYNLEKYYDPLIQSSTYLTRMMKY 5 ETI SY KL++ELD+ V++M+ SY LEKYYDPL S YL R +KY Sbjct: 128 ETI-SYSKLIVELDDAVIQMILGSYGLEKYYDPLKNSYMYLMRFIKY 173