BLASTX nr result
ID: Rehmannia27_contig00042080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00042080 (802 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075430.1| PREDICTED: microtubule-associated protein 70... 62 1e-07 gb|EYU18625.1| hypothetical protein MIMGU_mgv1a017496mg [Erythra... 55 8e-07 >ref|XP_011075430.1| PREDICTED: microtubule-associated protein 70-2-like [Sesamum indicum] Length = 600 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 12 MGSYQNCSNGEAEPQRLTSSGSFKARKKPAAAISQ 116 MGSYQNC NGEAEPQRLTSS SFKA+KKP AIS+ Sbjct: 1 MGSYQNCINGEAEPQRLTSSASFKAKKKPTPAISR 35 >gb|EYU18625.1| hypothetical protein MIMGU_mgv1a017496mg [Erythranthe guttata] Length = 71 Score = 55.1 bits (131), Expect = 8e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 12 MGSYQNCSNGEAEPQRLTSSGSFKARKKPAAAISQN 119 MGSY N GEAEPQ+LTSS SFKARKKPAAA+S+N Sbjct: 1 MGSYYN---GEAEPQKLTSSASFKARKKPAAAVSRN 33