BLASTX nr result
ID: Rehmannia27_contig00041937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00041937 (1159 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089658.1| PREDICTED: palmitoyl-protein thioesterase 1 ... 59 3e-06 ref|XP_012843517.1| PREDICTED: palmitoyl-protein thioesterase 1 ... 58 6e-06 >ref|XP_011089658.1| PREDICTED: palmitoyl-protein thioesterase 1 [Sesamum indicum] Length = 327 Score = 59.3 bits (142), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 1158 ILVPKETSWFGYFPDGSWETVLPAQQVPAF 1069 ILVPKETSWFGYFPDGSW+TVLPAQ+ + Sbjct: 224 ILVPKETSWFGYFPDGSWDTVLPAQETTLY 253 >ref|XP_012843517.1| PREDICTED: palmitoyl-protein thioesterase 1 [Erythranthe guttata] gi|604321326|gb|EYU31902.1| hypothetical protein MIMGU_mgv1a010171mg [Erythranthe guttata] Length = 320 Score = 58.2 bits (139), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 1158 ILVPKETSWFGYFPDGSWETVLPAQQVPAF 1069 ILVPKETSWFGYFPDGSWET+LPA + + Sbjct: 224 ILVPKETSWFGYFPDGSWETILPANETTLY 253