BLASTX nr result
ID: Rehmannia27_contig00040444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00040444 (390 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38515.1| hypothetical protein MIMGU_mgv1a0031091mg, partia... 119 4e-29 ref|XP_012831921.1| PREDICTED: interactor of constitutive active... 112 1e-26 ref|XP_011094702.1| PREDICTED: interactor of constitutive active... 110 1e-25 ref|XP_012082289.1| PREDICTED: interactor of constitutive active... 105 5e-24 ref|XP_010244974.1| PREDICTED: interactor of constitutive active... 103 2e-23 ref|XP_010253523.1| PREDICTED: interactor of constitutive active... 103 2e-23 ref|XP_009609418.1| PREDICTED: interactor of constitutive active... 101 1e-22 ref|XP_011077374.1| PREDICTED: interactor of constitutive active... 100 2e-22 emb|CAC84774.1| P70 protein [Nicotiana tabacum] 100 3e-22 ref|XP_009797643.1| PREDICTED: interactor of constitutive active... 100 3e-22 ref|XP_011094701.1| PREDICTED: interactor of constitutive active... 100 3e-22 ref|XP_015578502.1| PREDICTED: interactor of constitutive active... 100 4e-22 gb|ACU17370.1| unknown [Glycine max] 92 3e-21 ref|XP_010920923.1| PREDICTED: interactor of constitutive active... 97 3e-21 emb|CDP07955.1| unnamed protein product [Coffea canephora] 97 3e-21 ref|XP_003520644.1| PREDICTED: interactor of constitutive active... 97 3e-21 gb|KYP70845.1| hypothetical protein KK1_010083 [Cajanus cajan] 97 4e-21 gb|KJB33007.1| hypothetical protein B456_006G1686001 [Gossypium ... 96 2e-20 ref|XP_007027253.1| ROP interactive partner 3 isoform 1 [Theobro... 96 2e-20 ref|XP_010043696.1| PREDICTED: interactor of constitutive active... 96 2e-20 >gb|EYU38515.1| hypothetical protein MIMGU_mgv1a0031091mg, partial [Erythranthe guttata] Length = 505 Score = 119 bits (297), Expect = 4e-29 Identities = 58/94 (61%), Positives = 71/94 (75%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQT SRPG +DVPQKPS +TPR VRK+K N +SKTPK RSPK+VDRRS Sbjct: 1 MQTTKSRPGSIDVPQKPSPTTPRTVRKLKTPGSDSDSFSSPNPVSKTPKTRSPKIVDRRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 P++ +TEKK+P++V ELES+LAHLQ+ELKK DQ Sbjct: 61 PQSASTEKKRPNRVPELESKLAHLQEELKKVKDQ 94 >ref|XP_012831921.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic [Erythranthe guttata] gi|604342606|gb|EYU41630.1| hypothetical protein MIMGU_mgv1a003571mg [Erythranthe guttata] Length = 577 Score = 112 bits (281), Expect = 1e-26 Identities = 55/95 (57%), Positives = 72/95 (75%), Gaps = 1/95 (1%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP SRPG LDVPQKPS +TP+I RK+K N+ +KTPK+ SPK+VDR+S Sbjct: 1 MQTPTSRPGSLDVPQKPSPTTPKIARKLKTPGSNQDCVPSPNSATKTPKDNSPKIVDRKS 60 Query: 248 P-RNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 P RNLA E K+P+KV+E+E+++AHLQ+ELK A +Q Sbjct: 61 PRRNLAAENKRPNKVAEMEARIAHLQEELKAAKNQ 95 >ref|XP_011094702.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Sesamum indicum] gi|747093766|ref|XP_011094703.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Sesamum indicum] Length = 620 Score = 110 bits (274), Expect = 1e-25 Identities = 57/94 (60%), Positives = 68/94 (72%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP SRP LDVP++PS +T R RK+K N +SKTPK+RSPKVVDR+S Sbjct: 1 MQTPKSRPRSLDVPKRPSPTTYRTARKLKTPGSDSDSASSPNPVSKTPKDRSPKVVDRKS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR A EKK+PSKVSELE ++A LQ+ELKKA DQ Sbjct: 61 PRIPAIEKKRPSKVSELEPRIAQLQEELKKAKDQ 94 >ref|XP_012082289.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Jatropha curcas] gi|643717633|gb|KDP29076.1| hypothetical protein JCGZ_16465 [Jatropha curcas] Length = 623 Score = 105 bits (262), Expect = 5e-24 Identities = 51/94 (54%), Positives = 68/94 (72%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R G +VPQ+ S +TPR R++K N SKTPK++SPKV++RRS Sbjct: 1 MQTPKARTGSSEVPQRKSAATPRTARQLKIPGSDSDSVPSPNPASKTPKDKSPKVIERRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ ATEKK+PS++ ELE+QLA LQ++LKKA DQ Sbjct: 61 PRSPATEKKRPSRIPELEAQLAQLQEDLKKAKDQ 94 >ref|XP_010244974.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] gi|720090072|ref|XP_010244975.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] gi|720090075|ref|XP_010244976.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] gi|720090079|ref|XP_010244977.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] Length = 618 Score = 103 bits (258), Expect = 2e-23 Identities = 52/94 (55%), Positives = 67/94 (71%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R G +VPQ+ S TPR R++K +S+TPK+RSPKVV+RRS Sbjct: 1 MQTPKARSGSSEVPQRTSPGTPRAARQLKTTGSESDSVSSTTPVSRTPKDRSPKVVERRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ TEKK+PS+VSELESQLA L+++LKKA DQ Sbjct: 61 PRSPITEKKRPSRVSELESQLAQLKEDLKKAKDQ 94 >ref|XP_010253523.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Nelumbo nucifera] Length = 621 Score = 103 bits (258), Expect = 2e-23 Identities = 52/94 (55%), Positives = 67/94 (71%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R G +VPQ+ S TPR VR++K +++TPK+RSPKV +RRS Sbjct: 1 MQTPKTRSGSSEVPQRTSQGTPRAVRQLKTPGSDSDSVSSATPVNRTPKDRSPKVNERRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ TEKK+PS+VSELESQLA LQ++LKKA DQ Sbjct: 61 PRSPVTEKKRPSRVSELESQLAQLQEDLKKAKDQ 94 >ref|XP_009609418.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nicotiana tomentosiformis] Length = 608 Score = 101 bits (251), Expect = 1e-22 Identities = 52/94 (55%), Positives = 65/94 (69%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP SR ++VPQ+ S +TP+ RK+K N S+TPK+RSPKVV RRS Sbjct: 1 MQTPKSRTVSVEVPQRTSPATPKTTRKLKTPGSDADSVSSPNPASRTPKDRSPKVVGRRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ EKK+P KVS+LE+QLA LQ+ELKKA DQ Sbjct: 61 PRSPVMEKKRPGKVSDLETQLAQLQEELKKAKDQ 94 >ref|XP_011077374.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Sesamum indicum] gi|747061789|ref|XP_011077376.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Sesamum indicum] gi|747061791|ref|XP_011077377.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Sesamum indicum] gi|747061793|ref|XP_011077378.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Sesamum indicum] gi|747061795|ref|XP_011077379.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Sesamum indicum] Length = 612 Score = 100 bits (250), Expect = 2e-22 Identities = 53/94 (56%), Positives = 65/94 (69%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP SRPG LDVPQK S +T R K+K + +SKT K++SPK+VDRRS Sbjct: 1 MQTPKSRPGSLDVPQKFSPATTRTGGKLKTLGSDSDSMTSPSPVSKTLKDKSPKIVDRRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ A EKK+P++ SELE QL LQ+ELKKA DQ Sbjct: 61 PRSPAIEKKRPNRASELEPQLVQLQEELKKAKDQ 94 >emb|CAC84774.1| P70 protein [Nicotiana tabacum] Length = 601 Score = 100 bits (249), Expect = 3e-22 Identities = 51/94 (54%), Positives = 66/94 (70%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R ++VPQ+ S +TP+ RK+K N ++TPK+RSPKVV RRS Sbjct: 1 MQTPKARTVSVEVPQRTSPATPKTTRKLKTPGSDADSVSSPNPATRTPKDRSPKVVGRRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ EKK+PSKVS+LE+QLA LQ+ELKKA DQ Sbjct: 61 PRSPVIEKKRPSKVSDLEAQLAQLQEELKKAKDQ 94 >ref|XP_009797643.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nicotiana sylvestris] gi|698504197|ref|XP_009797644.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nicotiana sylvestris] gi|698504199|ref|XP_009797645.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nicotiana sylvestris] gi|698504201|ref|XP_009797646.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nicotiana sylvestris] Length = 601 Score = 100 bits (249), Expect = 3e-22 Identities = 51/94 (54%), Positives = 66/94 (70%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R ++VPQ+ S +TP+ RK+K N ++TPK+RSPKVV RRS Sbjct: 1 MQTPKARTVSVEVPQRTSPATPKTTRKLKTPGSDADSVSSPNPATRTPKDRSPKVVGRRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ EKK+PSKVS+LE+QLA LQ+ELKKA DQ Sbjct: 61 PRSPVIEKKRPSKVSDLEAQLAQLQEELKKAKDQ 94 >ref|XP_011094701.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Sesamum indicum] Length = 621 Score = 100 bits (249), Expect = 3e-22 Identities = 52/88 (59%), Positives = 63/88 (71%) Frame = +2 Query: 86 RPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRSPRNLAT 265 RP LDVP++PS +T R RK+K N +SKTPK+RSPKVVDR+SPR A Sbjct: 8 RPRSLDVPKRPSPTTYRTARKLKTPGSDSDSASSPNPVSKTPKDRSPKVVDRKSPRIPAI 67 Query: 266 EKKKPSKVSELESQLAHLQDELKKANDQ 349 EKK+PSKVSELE ++A LQ+ELKKA DQ Sbjct: 68 EKKRPSKVSELEPRIAQLQEELKKAKDQ 95 >ref|XP_015578502.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X3 [Ricinus communis] Length = 622 Score = 100 bits (248), Expect = 4e-22 Identities = 50/94 (53%), Positives = 66/94 (70%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R +VPQ+ S +TPR R++K N ++TPK++SPKV +RRS Sbjct: 1 MQTPKARTSSSEVPQRKSPATPRTARQLKTPGSDSDSVSSPNPANRTPKDKSPKVTERRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ A EKK+PS+VSELESQLA LQ++LKKA DQ Sbjct: 61 PRSPAIEKKRPSRVSELESQLAQLQEDLKKAKDQ 94 >gb|ACU17370.1| unknown [Glycine max] Length = 155 Score = 92.0 bits (227), Expect = 3e-21 Identities = 49/94 (52%), Positives = 63/94 (67%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R G DVPQK S PR VR++K + +K+ KERSPKV DRRS Sbjct: 1 MQTPKTRNGSSDVPQKVS---PRAVRQLKPTTLDIDSASSLSQATKSSKERSPKVTDRRS 57 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ E+K+PSK+SELESQ++ LQ++LKK DQ Sbjct: 58 PRSPVIERKRPSKISELESQISQLQNDLKKVRDQ 91 >ref|XP_010920923.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Elaeis guineensis] gi|743781571|ref|XP_010920924.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Elaeis guineensis] Length = 605 Score = 97.4 bits (241), Expect = 3e-21 Identities = 51/94 (54%), Positives = 64/94 (68%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP SR +VPQ+ S +TPR R K +T +KTP ERSPKVV+RRS Sbjct: 1 MQTPKSRTVSSEVPQRTSPATPRSTRVAKTEGHESDSSTSAHTPTKTPTERSPKVVERRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ ATE+K+PS++SELESQL LQ++LKK DQ Sbjct: 61 PRSPATERKRPSRISELESQLTQLQEDLKKTKDQ 94 >emb|CDP07955.1| unnamed protein product [Coffea canephora] Length = 618 Score = 97.4 bits (241), Expect = 3e-21 Identities = 50/94 (53%), Positives = 65/94 (69%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R ++PQK S +TPR +K+K N+ + KERSPKVVDRRS Sbjct: 1 MQTPKARTSSSELPQKTSPATPRTAQKLKTPGSEADSVSTSNSAGRMSKERSPKVVDRRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ ATEKK+ ++VS+LE+QLA LQ+ELKKA DQ Sbjct: 61 PRSPATEKKRATRVSDLETQLAQLQEELKKAKDQ 94 >ref|XP_003520644.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] gi|734340670|gb|KHN09475.1| Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] gi|947119396|gb|KRH67645.1| hypothetical protein GLYMA_03G178100 [Glycine max] Length = 621 Score = 97.4 bits (241), Expect = 3e-21 Identities = 49/94 (52%), Positives = 63/94 (67%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R G +VPQK S +TPR R++K N KTPK+RSPKV++ RS Sbjct: 1 MQTPKARVGASEVPQKKSPATPRTARQLKTPNSDAYSVSSPNAAKKTPKDRSPKVIECRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 P + +EKK+PSKV ELESQ+A LQ++LK A DQ Sbjct: 61 PHSPISEKKRPSKVQELESQIARLQEDLKNAKDQ 94 >gb|KYP70845.1| hypothetical protein KK1_010083 [Cajanus cajan] Length = 605 Score = 97.1 bits (240), Expect = 4e-21 Identities = 48/94 (51%), Positives = 62/94 (65%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R G +VPQK S TPR R++K N KTPK RSPKVV+RRS Sbjct: 1 MQTPKARAGTSEVPQKKSPVTPRTARQLKIPNSDSDLVSSPNAAKKTPKNRSPKVVERRS 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 P++ +EKK+PS++ ELESQ+ LQ++LK A DQ Sbjct: 61 PQSPVSEKKRPSRIQELESQITRLQEDLKSAKDQ 94 >gb|KJB33007.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] gi|763765796|gb|KJB33011.1| hypothetical protein B456_006G1686001 [Gossypium raimondii] Length = 619 Score = 95.5 bits (236), Expect = 2e-20 Identities = 48/94 (51%), Positives = 61/94 (64%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP R +VPQ+ S +TPR R++K N SKTPK+RSPKV +R+ Sbjct: 1 MQTPKGRTSSAEVPQRKSPATPRTARQLKIPGSDSEAVSSPNPASKTPKDRSPKVTERKV 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 R+ EKK+PS+V+ELESQL HLQD+LKK DQ Sbjct: 61 LRSPVAEKKRPSRVTELESQLTHLQDDLKKTKDQ 94 >ref|XP_007027253.1| ROP interactive partner 3 isoform 1 [Theobroma cacao] gi|508715858|gb|EOY07755.1| ROP interactive partner 3 isoform 1 [Theobroma cacao] Length = 619 Score = 95.5 bits (236), Expect = 2e-20 Identities = 49/94 (52%), Positives = 63/94 (67%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R L+VPQ+ S +TPR R++K N SKTPK+RSPKV R++ Sbjct: 1 MQTPKARTSSLEVPQRKSPATPRTARQLKTPGPDSDTVSSPNPASKTPKDRSPKVTARKA 60 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 R+ +EK++PSKVSELESQL LQD+LKK DQ Sbjct: 61 LRSPVSEKQRPSKVSELESQLTQLQDDLKKTKDQ 94 >ref|XP_010043696.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Eucalyptus grandis] gi|702272415|ref|XP_010043697.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Eucalyptus grandis] gi|629121190|gb|KCW85680.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] gi|629121191|gb|KCW85681.1| hypothetical protein EUGRSUZ_B02460 [Eucalyptus grandis] Length = 622 Score = 95.5 bits (236), Expect = 2e-20 Identities = 51/94 (54%), Positives = 67/94 (71%) Frame = +2 Query: 68 MQTPMSRPGYLDVPQKPSLSTPRIVRKIKXXXXXXXXXXXXNTISKTPKERSPKVVDRRS 247 MQTP +R G L+VPQ+ S PR VR++K N ++TPKERSPKVV+RRS Sbjct: 1 MQTPKARTG-LEVPQRVS---PRAVRQLKTATLEADSATSSNQATRTPKERSPKVVERRS 56 Query: 248 PRNLATEKKKPSKVSELESQLAHLQDELKKANDQ 349 PR+ +EKK+PS++SELESQ++ LQ+ELKK DQ Sbjct: 57 PRSPLSEKKRPSRISELESQISQLQEELKKTKDQ 90