BLASTX nr result
ID: Rehmannia27_contig00040017
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00040017 (1424 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA06883.1| hypothetical protein SOVF_176960 [Spinacia oleracea] 57 6e-06 >gb|KNA06883.1| hypothetical protein SOVF_176960 [Spinacia oleracea] Length = 195 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 2 DSDRDGKITGEQARNLFLSWRLPRGMLYSV*DL 100 D+DRDGKITGEQARNLFLSWRLPR +L V DL Sbjct: 4 DTDRDGKITGEQARNLFLSWRLPREVLEQVWDL 36