BLASTX nr result
ID: Rehmannia27_contig00039922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00039922 (376 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21446.1| hypothetical protein MIMGU_mgv1a020261mg, partial... 59 2e-08 >gb|EYU21446.1| hypothetical protein MIMGU_mgv1a020261mg, partial [Erythranthe guttata] Length = 199 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = -3 Query: 320 KISKKEGGQIGEAMIEVTPVRRSSRLRNRASVMSP 216 +I KKEGGQ GEAM+EVTP+RRS+R+RNRA+V+SP Sbjct: 165 RIKKKEGGQSGEAMVEVTPIRRSTRIRNRAAVISP 199