BLASTX nr result
ID: Rehmannia27_contig00039753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00039753 (455 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085890.1| PREDICTED: cytochrome c oxidase assembly pro... 81 8e-16 gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assemb... 80 9e-16 ref|XP_010474659.1| PREDICTED: cytochrome c oxidase assembly pro... 80 2e-15 ref|XP_010457216.1| PREDICTED: cytochrome c oxidase assembly pro... 80 2e-15 ref|XP_010480954.1| PREDICTED: cytochrome c oxidase assembly pro... 80 2e-15 ref|XP_009118769.1| PREDICTED: cytochrome c oxidase assembly pro... 80 2e-15 ref|XP_013647731.1| PREDICTED: cytochrome c oxidase assembly pro... 80 2e-15 ref|XP_013602195.1| PREDICTED: cytochrome c oxidase assembly pro... 80 2e-15 ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Caps... 80 3e-15 ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Co... 80 3e-15 ref|XP_002889401.1| cytochrome c oxidase assembly protein CtaG [... 80 3e-15 ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutr... 80 3e-15 emb|CDY15242.1| BnaC05g01210D [Brassica napus] 79 3e-15 ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prun... 77 6e-15 ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, par... 75 6e-15 ref|XP_009389648.1| PREDICTED: cytochrome c oxidase assembly pro... 76 9e-15 ref|XP_011653124.1| PREDICTED: cytochrome c oxidase assembly pro... 79 1e-14 ref|XP_008453793.1| PREDICTED: cytochrome c oxidase assembly pro... 79 1e-14 ref|XP_008453787.1| PREDICTED: cytochrome c oxidase assembly pro... 79 1e-14 gb|KHN24158.1| Cytochrome c oxidase assembly protein COX11, mito... 76 1e-14 >ref|XP_011085890.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Sesamum indicum] Length = 275 Score = 81.3 bits (199), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN Sbjct: 239 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 275 >gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assembly protein [Arabidopsis thaliana] Length = 216 Score = 80.1 bits (196), Expect = 9e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 163 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 199 >ref|XP_010474659.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Camelina sativa] Length = 283 Score = 80.1 bits (196), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 229 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 265 >ref|XP_010457216.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Camelina sativa] gi|727569377|ref|XP_010457217.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Camelina sativa] gi|727569379|ref|XP_010457219.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Camelina sativa] gi|727569381|ref|XP_010457220.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Camelina sativa] Length = 283 Score = 80.1 bits (196), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 229 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 265 >ref|XP_010480954.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Camelina sativa] gi|727429647|ref|XP_010480959.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Camelina sativa] Length = 283 Score = 80.1 bits (196), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 229 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 265 >ref|XP_009118769.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Brassica rapa] Length = 286 Score = 80.1 bits (196), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 233 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 269 >ref|XP_013647731.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Brassica napus] gi|674900441|emb|CDY32464.1| BnaA09g51320D [Brassica napus] Length = 286 Score = 80.1 bits (196), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 233 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 269 >ref|XP_013602195.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Brassica oleracea var. oleracea] gi|923747043|ref|XP_013673015.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Brassica napus] gi|674876886|emb|CDY55307.1| BnaC08g49630D [Brassica napus] Length = 286 Score = 80.1 bits (196), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 233 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 269 >ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] gi|482574193|gb|EOA38380.1| hypothetical protein CARUB_v10009922mg [Capsella rubella] Length = 287 Score = 80.1 bits (196), Expect = 3e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 234 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 270 >ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] gi|75151034|sp|Q8GWR0.1|COX11_ARATH RecName: Full=Cytochrome c oxidase assembly protein COX11, mitochondrial; Flags: Precursor gi|26452392|dbj|BAC43281.1| unknown protein [Arabidopsis thaliana] gi|28950841|gb|AAO63344.1| At1g02410 [Arabidopsis thaliana] gi|332189306|gb|AEE27427.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis thaliana] Length = 287 Score = 80.1 bits (196), Expect = 3e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 234 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 270 >ref|XP_002889401.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata subsp. lyrata] gi|297335243|gb|EFH65660.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata subsp. lyrata] Length = 287 Score = 80.1 bits (196), Expect = 3e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 234 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 270 >ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|567156392|ref|XP_006418345.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096114|gb|ESQ36696.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] gi|557096116|gb|ESQ36698.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum] Length = 291 Score = 80.1 bits (196), Expect = 3e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 238 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 274 >emb|CDY15242.1| BnaC05g01210D [Brassica napus] Length = 218 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEEN 344 D+PVFFYIDPEFETDP+MDGINNLILSYTFFKVSEEN Sbjct: 168 DVPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEEN 204 >ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] gi|462398186|gb|EMJ03854.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] Length = 177 Score = 77.0 bits (188), Expect = 6e-15 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 347 DMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVSEE Sbjct: 142 DMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 177 >ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] gi|557534814|gb|ESR45932.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina] Length = 119 Score = 75.5 bits (184), Expect = 6e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 347 DMPVFFYIDPEFETDP+MDGINNLILSYTFFKV+E+ Sbjct: 84 DMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED 119 >ref|XP_009389648.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 151 Score = 75.9 bits (185), Expect = 9e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 347 DMPVFFYIDPEFETDPKMDGINN+ILSYTFFKV+E+ Sbjct: 116 DMPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED 151 >ref|XP_011653124.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Cucumis sativus] gi|700198064|gb|KGN53222.1| hypothetical protein Csa_4G028460 [Cucumis sativus] Length = 333 Score = 79.0 bits (193), Expect = 1e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 347 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE Sbjct: 298 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 333 >ref|XP_008453793.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Cucumis melo] gi|659107670|ref|XP_008453794.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Cucumis melo] gi|659107672|ref|XP_008453795.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Cucumis melo] Length = 334 Score = 79.0 bits (193), Expect = 1e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 347 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE Sbjct: 299 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 334 >ref|XP_008453787.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Cucumis melo] gi|659107658|ref|XP_008453788.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Cucumis melo] gi|659107660|ref|XP_008453789.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Cucumis melo] gi|659107662|ref|XP_008453790.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Cucumis melo] gi|659107664|ref|XP_008453791.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Cucumis melo] gi|659107666|ref|XP_008453792.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Cucumis melo] Length = 337 Score = 79.0 bits (193), Expect = 1e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 347 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE Sbjct: 302 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 337 >gb|KHN24158.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Glycine soja] Length = 177 Score = 76.3 bits (186), Expect = 1e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 454 DMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 347 DMPVFFYIDPEFETDPKM+GINN+ILSYTFFKVSEE Sbjct: 142 DMPVFFYIDPEFETDPKMNGINNIILSYTFFKVSEE 177