BLASTX nr result
ID: Rehmannia27_contig00039731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00039731 (373 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088179.1| PREDICTED: thioredoxin domain-containing pro... 86 2e-18 ref|XP_011091750.1| PREDICTED: thioredoxin domain-containing pro... 82 3e-17 ref|XP_015056921.1| PREDICTED: thioredoxin domain-containing pro... 82 9e-17 ref|XP_004250298.1| PREDICTED: thioredoxin domain-containing pro... 82 9e-17 ref|XP_006352322.1| PREDICTED: thioredoxin domain-containing pro... 82 9e-17 ref|XP_009599692.1| PREDICTED: thioredoxin domain-containing pro... 81 1e-16 ref|XP_009776292.1| PREDICTED: thioredoxin domain-containing pro... 81 2e-16 gb|EPS58044.1| hypothetical protein M569_16771 [Genlisea aurea] 81 2e-16 emb|CDO97246.1| unnamed protein product [Coffea canephora] 81 2e-16 ref|XP_012836880.1| PREDICTED: thioredoxin domain-containing pro... 80 3e-16 ref|XP_008455854.1| PREDICTED: thioredoxin domain-containing pro... 80 3e-16 ref|XP_011650010.1| PREDICTED: thioredoxin domain-containing pro... 80 3e-16 gb|KRG91067.1| hypothetical protein GLYMA_20G131000 [Glycine max] 79 4e-16 gb|EMT15099.1| hypothetical protein F775_15491 [Aegilops tauschii] 78 6e-16 ref|XP_009767764.1| PREDICTED: thioredoxin domain-containing pro... 79 6e-16 ref|XP_015942041.1| PREDICTED: thioredoxin domain-containing pro... 79 9e-16 ref|XP_009396930.1| PREDICTED: thioredoxin domain-containing pro... 79 9e-16 ref|XP_002313888.1| hypothetical protein POPTR_0009s09570g [Popu... 79 9e-16 gb|EAZ06220.1| hypothetical protein OsI_28462 [Oryza sativa Indi... 78 1e-15 ref|XP_014512205.1| PREDICTED: thioredoxin domain-containing pro... 79 1e-15 >ref|XP_011088179.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Sesamum indicum] Length = 210 Score = 85.9 bits (211), Expect = 2e-18 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHL+I AKQHIET FVKINAEKSLYLSEKLRI+VLPTLALVKNAK Sbjct: 100 KVMDKHLAILAKQHIETRFVKINAEKSLYLSEKLRIVVLPTLALVKNAK 148 >ref|XP_011091750.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Sesamum indicum] Length = 175 Score = 82.0 bits (201), Expect = 3e-17 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHL+I KQHIET FVKINAEKS+YLSEKLRI+VLPTLAL KNAK Sbjct: 63 KVMDKHLNILVKQHIETRFVKINAEKSMYLSEKLRIVVLPTLALAKNAK 111 >ref|XP_015056921.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Solanum pennellii] Length = 212 Score = 81.6 bits (200), Expect = 9e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKINAEK+ YL+EKLRI+VLPTLAL+KNAK Sbjct: 99 KVMDKHLSILAKQHIETRFVKINAEKAPYLAEKLRIVVLPTLALIKNAK 147 >ref|XP_004250298.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Solanum lycopersicum] Length = 212 Score = 81.6 bits (200), Expect = 9e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKINAEK+ YL+EKLRI+VLPTLAL+KNAK Sbjct: 99 KVMDKHLSILAKQHIETRFVKINAEKAPYLAEKLRIVVLPTLALIKNAK 147 >ref|XP_006352322.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Solanum tuberosum] Length = 214 Score = 81.6 bits (200), Expect = 9e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKINAEK+ YL+EKLRI+VLPTLAL+KNAK Sbjct: 99 KVMDKHLSILAKQHIETRFVKINAEKTPYLAEKLRIVVLPTLALIKNAK 147 >ref|XP_009599692.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Nicotiana tomentosiformis] Length = 210 Score = 81.3 bits (199), Expect = 1e-16 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKI+AEKS YL+EKLRI+VLPTLALVKNAK Sbjct: 100 KVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKLRIVVLPTLALVKNAK 148 >ref|XP_009776292.1| PREDICTED: thioredoxin domain-containing protein 9 homolog isoform X1 [Nicotiana sylvestris] gi|698576720|ref|XP_009776293.1| PREDICTED: thioredoxin domain-containing protein 9 homolog isoform X2 [Nicotiana sylvestris] Length = 210 Score = 80.9 bits (198), Expect = 2e-16 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKI+AEKS YL+EKLR++VLPTLALVKNAK Sbjct: 100 KVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKLRVVVLPTLALVKNAK 148 >gb|EPS58044.1| hypothetical protein M569_16771 [Genlisea aurea] Length = 211 Score = 80.9 bits (198), Expect = 2e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHL++ AK H+ET FVKINAEKSLYLSEKLRI+VLPTLALVK+AK Sbjct: 100 KVMDKHLAVLAKNHLETKFVKINAEKSLYLSEKLRIVVLPTLALVKHAK 148 >emb|CDO97246.1| unnamed protein product [Coffea canephora] Length = 213 Score = 80.9 bits (198), Expect = 2e-16 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKI+AEKS YL+EKLRI+VLPTLAL+KNAK Sbjct: 100 KVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKLRIVVLPTLALIKNAK 148 >ref|XP_012836880.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Erythranthe guttata] gi|604333253|gb|EYU37604.1| hypothetical protein MIMGU_mgv1a013704mg [Erythranthe guttata] Length = 212 Score = 80.1 bits (196), Expect = 3e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +V+DKHL+I AKQHIET FVKINAEKS YL EKLRI+VLPTLALVKNAK Sbjct: 100 KVVDKHLAILAKQHIETRFVKINAEKSPYLCEKLRIIVLPTLALVKNAK 148 >ref|XP_008455854.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis melo] gi|659111681|ref|XP_008455855.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis melo] Length = 213 Score = 80.1 bits (196), Expect = 3e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKINAEKS +L+EKL+I+VLPTLAL+KNAK Sbjct: 100 KVMDKHLSILAKQHIETRFVKINAEKSPFLAEKLKIVVLPTLALIKNAK 148 >ref|XP_011650010.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Cucumis sativus] gi|700208142|gb|KGN63261.1| hypothetical protein Csa_2G418960 [Cucumis sativus] Length = 213 Score = 80.1 bits (196), Expect = 3e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKINAEKS +L+EKL+I+VLPTLAL+KNAK Sbjct: 100 KVMDKHLSILAKQHIETRFVKINAEKSPFLAEKLKIVVLPTLALIKNAK 148 >gb|KRG91067.1| hypothetical protein GLYMA_20G131000 [Glycine max] Length = 155 Score = 78.6 bits (192), Expect = 4e-16 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHL+I AKQHIET FVK+NAEKS +L+EKL+I+VLPTLAL+KNAK Sbjct: 100 KVMDKHLNILAKQHIETRFVKLNAEKSPFLAEKLKIIVLPTLALIKNAK 148 >gb|EMT15099.1| hypothetical protein F775_15491 [Aegilops tauschii] Length = 145 Score = 77.8 bits (190), Expect = 6e-16 Identities = 36/49 (73%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 QVMDKH+SI AKQH+ET F+K++AEK+ +L+EKLR++VLPTLALVKNAK Sbjct: 33 QVMDKHMSILAKQHVETRFIKVHAEKAPFLTEKLRVVVLPTLALVKNAK 81 >ref|XP_009767764.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Nicotiana sylvestris] Length = 210 Score = 79.3 bits (194), Expect = 6e-16 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET FVKI+AEKS YL+EKLRI+VLPTLALVK+AK Sbjct: 100 KVMDKHLSILAKQHIETRFVKIHAEKSPYLAEKLRIVVLPTLALVKHAK 148 >ref|XP_015942041.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Arachis duranensis] Length = 210 Score = 79.0 bits (193), Expect = 9e-16 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +V+DKHLSI AKQHIET FVKINAEKS +L+EKL+I+VLPTLAL+KNAK Sbjct: 100 KVVDKHLSILAKQHIETRFVKINAEKSPFLAEKLKIIVLPTLALIKNAK 148 >ref|XP_009396930.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Musa acuminata subsp. malaccensis] Length = 211 Score = 79.0 bits (193), Expect = 9e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHLSI AKQHIET F+KI+AEKS +L+EKLRI+VLPTLALVKNAK Sbjct: 99 KVMDKHLSILAKQHIETRFLKIHAEKSPFLTEKLRIIVLPTLALVKNAK 147 >ref|XP_002313888.1| hypothetical protein POPTR_0009s09570g [Populus trichocarpa] gi|118484130|gb|ABK93948.1| unknown [Populus trichocarpa] gi|222850296|gb|EEE87843.1| hypothetical protein POPTR_0009s09570g [Populus trichocarpa] Length = 213 Score = 79.0 bits (193), Expect = 9e-16 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKH+ I AKQHIET FVKINAEKS +L+EKL+ILVLPTLAL+KNAK Sbjct: 100 KVMDKHMGILAKQHIETRFVKINAEKSPFLAEKLKILVLPTLALIKNAK 148 >gb|EAZ06220.1| hypothetical protein OsI_28462 [Oryza sativa Indica Group] Length = 190 Score = 78.2 bits (191), Expect = 1e-15 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -1 Query: 187 ISSLGMMFSCS*FQVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKN 8 +S ++ C+ VMDKHLSI AKQH+ET FVK++AEK+ +L+EKLRI+VLPTLALVKN Sbjct: 66 VSLQRVLHGCAYQMVMDKHLSILAKQHVETRFVKVHAEKAPFLTEKLRIVVLPTLALVKN 125 Query: 7 AK 2 K Sbjct: 126 TK 127 >ref|XP_014512205.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Vigna radiata var. radiata] Length = 213 Score = 78.6 bits (192), Expect = 1e-15 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -1 Query: 148 QVMDKHLSISAKQHIETCFVKINAEKSLYLSEKLRILVLPTLALVKNAK 2 +VMDKHL++ AKQHIET FVKINAEKS +L+EKL+I+VLPTLAL+KNAK Sbjct: 100 KVMDKHLNLLAKQHIETRFVKINAEKSPFLAEKLKIIVLPTLALIKNAK 148