BLASTX nr result
ID: Rehmannia27_contig00038947
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038947 (539 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071155.1| PREDICTED: uncharacterized protein LOC105156... 77 2e-13 ref|XP_011086667.1| PREDICTED: muscle M-line assembly protein un... 76 6e-13 ref|XP_012845509.1| PREDICTED: uncharacterized protein LOC105965... 59 5e-07 ref|XP_012855313.1| PREDICTED: uncharacterized protein LOC105974... 57 2e-06 >ref|XP_011071155.1| PREDICTED: uncharacterized protein LOC105156652 [Sesamum indicum] Length = 619 Score = 77.4 bits (189), Expect = 2e-13 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 7/57 (12%) Frame = +2 Query: 2 RSGFAERPRSRQGAYEETRS-------FTNAPYQEPRVVDYNERPRSRGTGNSWSRP 151 RSGF+ERPRSR GAYEET+S FT+ YQEPR D+++RPRSRG+ NSW+RP Sbjct: 535 RSGFSERPRSRSGAYEETKSVYPRRSSFTHGAYQEPRAADFSDRPRSRGSVNSWTRP 591 >ref|XP_011086667.1| PREDICTED: muscle M-line assembly protein unc-89-like [Sesamum indicum] Length = 613 Score = 75.9 bits (185), Expect = 6e-13 Identities = 38/56 (67%), Positives = 41/56 (73%), Gaps = 7/56 (12%) Frame = +2 Query: 2 RSGFAERPRSRQGAYEETR-------SFTNAPYQEPRVVDYNERPRSRGTGNSWSR 148 R G ERPRSRQGAYE+ R SFT+ YQEPR VDYNERPRSRGT NSW+R Sbjct: 529 RPGSHERPRSRQGAYEDPRGSFPQRSSFTHGGYQEPRAVDYNERPRSRGTTNSWTR 584 >ref|XP_012845509.1| PREDICTED: uncharacterized protein LOC105965503 [Erythranthe guttata] gi|604319430|gb|EYU30622.1| hypothetical protein MIMGU_mgv1a003991mg [Erythranthe guttata] Length = 551 Score = 58.5 bits (140), Expect = 5e-07 Identities = 34/61 (55%), Positives = 40/61 (65%), Gaps = 11/61 (18%) Frame = +2 Query: 2 RSGFAERPRSRQG-AYEETR---------SFTNAPYQEP-RVVDYNERPRSRGTGNSWSR 148 R G +RPRSR G AY+E+R SFT YQ+P R VD+ ERPRSRGT NSW+R Sbjct: 463 RPGSRDRPRSRPGPAYDESRGGNFPQRSSSFTTGAYQDPNRGVDFVERPRSRGTVNSWAR 522 Query: 149 P 151 P Sbjct: 523 P 523 >ref|XP_012855313.1| PREDICTED: uncharacterized protein LOC105974721 [Erythranthe guttata] gi|604303015|gb|EYU22540.1| hypothetical protein MIMGU_mgv1a004532mg [Erythranthe guttata] Length = 522 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/58 (55%), Positives = 37/58 (63%), Gaps = 9/58 (15%) Frame = +2 Query: 2 RSGFAERPRSRQGAYEETR--------SFTNAPYQE-PRVVDYNERPRSRGTGNSWSR 148 RSGF ERPRSR GAYEE S T+ YQE R +YNERP SRG+ +SW+R Sbjct: 448 RSGFHERPRSRPGAYEENNRSVYPQRSSITHGAYQEQSRGGNYNERPSSRGSTDSWTR 505