BLASTX nr result
ID: Rehmannia27_contig00038878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038878 (548 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43920.1| hypothetical protein MIMGU_mgv1a0053871mg, partia... 59 3e-07 ref|XP_012858954.1| PREDICTED: zinc finger CCCH domain-containin... 59 3e-07 ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containin... 58 1e-06 ref|XP_012481175.1| PREDICTED: zinc finger CCCH domain-containin... 56 3e-06 gb|ACJ85626.1| unknown [Medicago truncatula] 54 7e-06 >gb|EYU43920.1| hypothetical protein MIMGU_mgv1a0053871mg, partial [Erythranthe guttata] Length = 357 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 547 YLRTGFCGYGNRCRFNHPRDRSMV 476 YLRTGFCGYGNRCRFNHPRDRSMV Sbjct: 58 YLRTGFCGYGNRCRFNHPRDRSMV 81 >ref|XP_012858954.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like [Erythranthe guttata] Length = 485 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 547 YLRTGFCGYGNRCRFNHPRDRSMV 476 YLRTGFCGYGNRCRFNHPRDRSMV Sbjct: 58 YLRTGFCGYGNRCRFNHPRDRSMV 81 >ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Sesamum indicum] Length = 496 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 547 YLRTGFCGYGNRCRFNHPRDRSM 479 YLRTGFCGYGNRCRFNHPRDRSM Sbjct: 68 YLRTGFCGYGNRCRFNHPRDRSM 90 >ref|XP_012481175.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Gossypium raimondii] gi|763761367|gb|KJB28621.1| hypothetical protein B456_005G058800 [Gossypium raimondii] Length = 459 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 547 YLRTGFCGYGNRCRFNHPRDRSMVKSLILQAIG 449 YLRTGFCGYG+RCRFNHP DR+MV + +IG Sbjct: 50 YLRTGFCGYGSRCRFNHPHDRAMVMGPGISSIG 82 >gb|ACJ85626.1| unknown [Medicago truncatula] Length = 162 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -2 Query: 547 YLRTGFCGYGNRCRFNHPRDRSMVKSLI 464 Y+RTGFCGYG RCRFNHPRDR+ V + + Sbjct: 58 YMRTGFCGYGGRCRFNHPRDRAAVAAAV 85