BLASTX nr result
ID: Rehmannia27_contig00038870
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038870 (699 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845720.2| PREDICTED: xyloglucan endotransglucosylase/h... 46 5e-09 gb|ERN07395.1| hypothetical protein AMTR_s00019p00243070, partia... 46 6e-09 gb|AGC54941.1| xyloglucan endotransglucosylase [Gossypium hirsutum] 48 2e-08 ref|XP_012488228.1| PREDICTED: xyloglucan endotransglucosylase/h... 48 2e-08 gb|KJB42503.1| hypothetical protein B456_007G155700 [Gossypium r... 48 2e-08 ref|XP_010039133.1| PREDICTED: xyloglucan endotransglucosylase/h... 50 3e-08 ref|XP_008229402.1| PREDICTED: brassinosteroid-regulated protein... 44 3e-08 ref|XP_012854698.1| PREDICTED: xyloglucan endotransglucosylase/h... 47 4e-08 ref|XP_011044805.1| PREDICTED: brassinosteroid-regulated protein... 44 7e-08 ref|XP_015893429.1| PREDICTED: xyloglucan endotransglucosylase/h... 45 7e-08 ref|XP_011044804.1| PREDICTED: brassinosteroid-regulated protein... 44 7e-08 ref|XP_002306736.2| xyloglucan endo-1 family protein [Populus tr... 44 7e-08 ref|XP_006387415.1| xyloglucan endo-1 family protein, partial [P... 44 7e-08 ref|XP_006387414.1| hypothetical protein POPTR_1065s00200g, part... 44 7e-08 gb|KCW49117.1| hypothetical protein EUGRSUZ_K02715, partial [Euc... 45 7e-08 ref|XP_006387118.1| hypothetical protein POPTR_1795s00200g, part... 44 8e-08 gb|KNA11675.1| hypothetical protein SOVF_133150 [Spinacia oleracea] 44 1e-07 ref|XP_007049743.1| Xyloglucan endotransglucosylase/hydrolase pr... 47 1e-07 ref|XP_010673334.1| PREDICTED: xyloglucan endotransglucosylase/h... 44 1e-07 gb|ACD03220.1| xyloglucan endotransglucosylase/hydrolase 10 [Act... 45 1e-07 >ref|XP_006845720.2| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 22 [Amborella trichopoda] Length = 285 Score = 45.8 bits (107), Expect(2) = 5e-09 Identities = 22/38 (57%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+D+E LG+ +G PYTL+TNVYTQ N F L Sbjct: 97 THDEIDYEFLGNLSGEPYTLHTNVYTQGKGNREQQFHL 134 Score = 42.4 bits (98), Expect(2) = 5e-09 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF+L FDP + FH Y ILWNQK Sbjct: 129 EQQFHLWFDPRAGFHTYSILWNQK 152 >gb|ERN07395.1| hypothetical protein AMTR_s00019p00243070, partial [Amborella trichopoda] Length = 155 Score = 45.8 bits (107), Expect(2) = 6e-09 Identities = 22/38 (57%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+D+E LG+ +G PYTL+TNVYTQ N F L Sbjct: 97 THDEIDYEFLGNLSGEPYTLHTNVYTQGKGNREQQFHL 134 Score = 42.4 bits (98), Expect(2) = 6e-09 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF+L FDP + FH Y ILWNQK Sbjct: 129 EQQFHLWFDPRAGFHTYSILWNQK 152 >gb|AGC54941.1| xyloglucan endotransglucosylase [Gossypium hirsutum] Length = 293 Score = 48.1 bits (113), Expect(2) = 2e-08 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -1 Query: 630 NGRGEFTHDELDFELLGHNGPPYTLNTNVYTQDTENNNSIFCL 502 +G+G HDELDFE LG NGPP+TL TNV+ D F L Sbjct: 96 DGKGG-NHDELDFEFLGSNGPPFTLQTNVFANDEGGREQRFHL 137 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQ 458 EQ+F+L FDP+S FH Y I+WNQ Sbjct: 132 EQRFHLWFDPTSDFHTYGIVWNQ 154 >ref|XP_012488228.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 2-like [Gossypium raimondii] Length = 285 Score = 48.1 bits (113), Expect(2) = 2e-08 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -1 Query: 630 NGRGEFTHDELDFELLGHNGPPYTLNTNVYTQDTENNNSIFCL 502 +G+G HDELDFE LG NGPP+TL TNV+ D F L Sbjct: 88 DGKGG-NHDELDFEFLGSNGPPFTLQTNVFANDEGGREQRFHL 129 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQ 458 EQ+F+L FDP+S FH Y I+WNQ Sbjct: 124 EQRFHLWFDPTSDFHTYGIVWNQ 146 >gb|KJB42503.1| hypothetical protein B456_007G155700 [Gossypium raimondii] Length = 258 Score = 48.1 bits (113), Expect(2) = 2e-08 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -1 Query: 630 NGRGEFTHDELDFELLGHNGPPYTLNTNVYTQDTENNNSIFCL 502 +G+G HDELDFE LG NGPP+TL TNV+ D F L Sbjct: 88 DGKGG-NHDELDFEFLGSNGPPFTLQTNVFANDEGGREQRFHL 129 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQ 458 EQ+F+L FDP+S FH Y I+WNQ Sbjct: 124 EQRFHLWFDPTSDFHTYGIVWNQ 146 >ref|XP_010039133.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 2 [Eucalyptus grandis] gi|629082674|gb|KCW49119.1| hypothetical protein EUGRSUZ_K02717 [Eucalyptus grandis] Length = 280 Score = 50.1 bits (118), Expect(2) = 3e-08 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = -1 Query: 618 EFTHDELDFELLGHNGPPYTLNTNVYTQDTENNNSIFCL 502 E HDE+DFE +G NGPPYTL+TNVYT+ F L Sbjct: 97 ESLHDEVDFEFIGSNGPPYTLSTNVYTKGVGGREQNFHL 135 Score = 35.4 bits (80), Expect(2) = 3e-08 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWN 461 EQ F+L FDP++ FH Y+++WN Sbjct: 130 EQNFHLWFDPTTDFHSYKLVWN 151 >ref|XP_008229402.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus mume] Length = 279 Score = 43.9 bits (102), Expect(2) = 3e-08 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ +G PYTL+TNV++Q N F L Sbjct: 98 THDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFNL 135 Score = 41.6 bits (96), Expect(2) = 3e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQFNL FDP+ AFH Y I+WN + Sbjct: 130 EQQFNLWFDPTKAFHTYSIVWNSQ 153 >ref|XP_012854698.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 2-like [Erythranthe guttata] gi|604303244|gb|EYU22717.1| hypothetical protein MIMGU_mgv1a020473mg [Erythranthe guttata] Length = 285 Score = 46.6 bits (109), Expect(2) = 4e-08 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQ 458 EQQFNL FDPSS FH+Y+ILWNQ Sbjct: 137 EQQFNLWFDPSSQFHNYQILWNQ 159 Score = 38.5 bits (88), Expect(2) = 4e-08 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = -1 Query: 609 HDELDFELLGHNGPPYTLNTNVYTQDTENNNSIFCL 502 HDELDFE + + Y LNTNV+ QD+ N F L Sbjct: 107 HDELDFEFILNEKGRYVLNTNVFAQDSGNREQQFNL 142 >ref|XP_011044805.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus euphratica] Length = 342 Score = 43.9 bits (102), Expect(2) = 7e-08 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ G PYTL+TNV++Q N F L Sbjct: 150 THDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYL 187 Score = 40.4 bits (93), Expect(2) = 7e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF L FDP+ AFH Y I+WNQ+ Sbjct: 182 EQQFYLWFDPTKAFHTYSIVWNQQ 205 >ref|XP_015893429.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Ziziphus jujuba] Length = 300 Score = 45.4 bits (106), Expect(2) = 7e-08 Identities = 22/38 (57%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ +G PYTL+TNV+TQ N F L Sbjct: 104 THDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFHL 141 Score = 38.9 bits (89), Expect(2) = 7e-08 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF+L FDP+ AFH Y ++WN + Sbjct: 136 EQQFHLWFDPTKAFHTYSLVWNPR 159 >ref|XP_011044804.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus euphratica] Length = 295 Score = 43.9 bits (102), Expect(2) = 7e-08 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ G PYTL+TNV++Q N F L Sbjct: 103 THDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYL 140 Score = 40.4 bits (93), Expect(2) = 7e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF L FDP+ AFH Y I+WNQ+ Sbjct: 135 EQQFYLWFDPTKAFHTYSIVWNQQ 158 >ref|XP_002306736.2| xyloglucan endo-1 family protein [Populus trichocarpa] gi|550339523|gb|EEE93732.2| xyloglucan endo-1 family protein [Populus trichocarpa] Length = 294 Score = 43.9 bits (102), Expect(2) = 7e-08 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ G PYTL+TNV++Q N F L Sbjct: 102 THDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYL 139 Score = 40.4 bits (93), Expect(2) = 7e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF L FDP+ AFH Y I+WNQ+ Sbjct: 134 EQQFYLWFDPTKAFHTYSIVWNQQ 157 >ref|XP_006387415.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa] gi|550307016|gb|ERP46329.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa] Length = 271 Score = 43.9 bits (102), Expect(2) = 7e-08 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ G PYTL+TNV++Q N F L Sbjct: 79 THDEIDFEFLGNLTGEPYTLHTNVFSQGKGNKEQQFYL 116 Score = 40.4 bits (93), Expect(2) = 7e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF L FDP+ AFH Y I+WNQ+ Sbjct: 111 EQQFYLWFDPTKAFHTYSIVWNQQ 134 >ref|XP_006387414.1| hypothetical protein POPTR_1065s00200g, partial [Populus trichocarpa] gi|550307015|gb|ERP46328.1| hypothetical protein POPTR_1065s00200g, partial [Populus trichocarpa] Length = 270 Score = 43.9 bits (102), Expect(2) = 7e-08 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ G PYTL+TNV++Q N F L Sbjct: 123 THDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYL 160 Score = 40.4 bits (93), Expect(2) = 7e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF L FDP+ AFH Y I+WNQ+ Sbjct: 155 EQQFYLWFDPTKAFHTYSIVWNQQ 178 >gb|KCW49117.1| hypothetical protein EUGRSUZ_K02715, partial [Eucalyptus grandis] Length = 260 Score = 44.7 bits (104), Expect(2) = 7e-08 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = -1 Query: 618 EFTHDELDFELLGHNGPPYTLNTNVYTQDTENNNSIFCL 502 E HDE+DFE +G NGPP+ L+TNV+T+ F L Sbjct: 76 EAHHDEIDFEFIGSNGPPFDLSTNVFTKGVGGREQKFRL 114 Score = 39.7 bits (91), Expect(2) = 7e-08 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQ 458 EQ+F L FDPS+ FH Y ILWNQ Sbjct: 109 EQKFRLWFDPSTDFHSYTILWNQ 131 >ref|XP_006387118.1| hypothetical protein POPTR_1795s00200g, partial [Populus trichocarpa] gi|550305058|gb|ERP46032.1| hypothetical protein POPTR_1795s00200g, partial [Populus trichocarpa] Length = 214 Score = 43.9 bits (102), Expect(2) = 8e-08 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ G PYTL+TNV++Q N F L Sbjct: 39 THDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYL 76 Score = 40.4 bits (93), Expect(2) = 8e-08 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF L FDP+ AFH Y I+WNQ+ Sbjct: 71 EQQFYLWFDPTKAFHTYSIVWNQQ 94 >gb|KNA11675.1| hypothetical protein SOVF_133150 [Spinacia oleracea] Length = 288 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -1 Query: 651 ISLVYADNGRGEFTHDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 ++ +Y + + HDE+DFE LG+ +G PYTL+TNV++Q N F L Sbjct: 98 VTTLYLTSDQSTGRHDEIDFEFLGNVSGQPYTLHTNVFSQGQGNREQQFHL 148 Score = 40.0 bits (92), Expect(2) = 1e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF+L FDP+S FH Y I+WN K Sbjct: 143 EQQFHLWFDPTSNFHTYSIVWNPK 166 >ref|XP_007049743.1| Xyloglucan endotransglucosylase/hydrolase protein 2, putative [Theobroma cacao] gi|508702004|gb|EOX93900.1| Xyloglucan endotransglucosylase/hydrolase protein 2, putative [Theobroma cacao] Length = 285 Score = 47.0 bits (110), Expect(2) = 1e-07 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = -1 Query: 654 IISLVYADNGRGEFTHDELDFELLGHNGPPYTLNTNVYTQD 532 +++ Y + +GE HDELDFE LG G P TL TNV+ D Sbjct: 84 VVTAFYLIDNKGEGDHDELDFEFLGSKGQPCTLQTNVFAND 124 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQ 458 EQ+++L FDP++ FH Y ILWNQ Sbjct: 129 EQRYHLWFDPTADFHTYGILWNQ 151 >ref|XP_010673334.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 24-like [Beta vulgaris subsp. vulgaris] gi|870863871|gb|KMT15018.1| hypothetical protein BVRB_3g065220 [Beta vulgaris subsp. vulgaris] Length = 285 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = -1 Query: 651 ISLVYADNGRGEFTHDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 ++ +Y + + HDE+DFE LG+ G PYTL+TNV++Q N F L Sbjct: 96 VTTLYLSSDQSTGRHDEIDFEFLGNVTGQPYTLHTNVFSQGEGNREQQFHL 146 Score = 40.0 bits (92), Expect(2) = 1e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF+L FDP+ FH Y I+WNQK Sbjct: 141 EQQFHLWFDPTINFHTYSIVWNQK 164 >gb|ACD03220.1| xyloglucan endotransglucosylase/hydrolase 10 [Actinidia deliciosa] Length = 283 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 22/38 (57%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 612 THDELDFELLGH-NGPPYTLNTNVYTQDTENNNSIFCL 502 THDE+DFE LG+ +G PYTL+TNV+TQ N F L Sbjct: 95 THDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFHL 132 Score = 38.5 bits (88), Expect(2) = 1e-07 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -3 Query: 526 EQQFNLLFDPSSAFHDYEILWNQK 455 EQQF+L FDP+ FH Y ILWN + Sbjct: 127 EQQFHLWFDPTKDFHTYSILWNPR 150