BLASTX nr result
ID: Rehmannia27_contig00038836
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038836 (808 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETX03503.1| hypothetical protein ETSY1_47025 (plasmid) [Candi... 92 8e-21 gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trif... 87 4e-18 ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [S... 83 2e-17 ref|WP_016885142.1| MULTISPECIES: hypothetical protein [Bacteria] 79 6e-16 ref|WP_045623793.1| hypothetical protein [Vibrio vulnificus] gi|... 79 6e-16 ref|WP_046876397.1| hypothetical protein, partial [Vibrio paraha... 79 7e-16 dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella comp... 83 1e-15 ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 ... 78 2e-15 ref|XP_013946733.1| hypothetical protein TRIATDRAFT_255346 [Tric... 78 2e-15 ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipol... 78 3e-15 gb|KUJ06143.1| hypothetical protein LY89DRAFT_703091 [Phialoceph... 78 5e-15 gb|KNA06142.1| hypothetical protein SOVF_183600 [Spinacia oleracea] 77 7e-15 gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] 76 1e-14 gb|KDQ32289.1| hypothetical protein PLEOSDRAFT_23300, partial [P... 75 4e-14 ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melam... 76 5e-14 ref|XP_002488959.1| hypothetical protein SORBIDRAFT_1180s002020 ... 74 1e-13 gb|KRG68574.1| hypothetical protein GLYMA_U007300 [Glycine max] 75 3e-13 ref|XP_009534205.1| hypothetical protein PHYSODRAFT_287468 [Phyt... 72 3e-13 ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melam... 72 3e-13 ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, part... 72 4e-13 >gb|ETX03503.1| hypothetical protein ETSY1_47025 (plasmid) [Candidatus Entotheonella sp. TSY1] Length = 68 Score = 92.4 bits (228), Expect = 8e-21 Identities = 47/60 (78%), Positives = 50/60 (83%) Frame = +3 Query: 513 LLVSEAEVMINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQIPS 692 LLVS AEVMI RDSWG SY +VRGEIL ++DEQVRKH RMFSLIKNES G EDDQIPS Sbjct: 9 LLVSRAEVMIERDSWGHSYLIVRGEILGFMKDEQVRKHLPRMFSLIKNESWGFEDDQIPS 68 >gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trifallax] Length = 111 Score = 86.7 bits (213), Expect = 4e-18 Identities = 43/82 (52%), Positives = 46/82 (56%) Frame = -1 Query: 253 NYELFNRNSFNIRCWSWNYRGCWHQTCPPMDXXXXXXXXXXXXXXXXXXXXXXXCYYLKV 74 NYELFN N+FNIR WSWNYRGCWHQTCPP+D C+YL Sbjct: 20 NYELFNCNNFNIRYWSWNYRGCWHQTCPPID-PRKGVQILLIAIPKHRLRSVISCHYLPE 78 Query: 73 FLLGNFRACCLPWKW*QFL*AP 8 LGN RACCLP W FL P Sbjct: 79 SGLGNLRACCLPQMWQPFLRLP 100 >ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [Sorghum bicolor] Length = 52 Score = 83.2 bits (204), Expect = 2e-17 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = +3 Query: 537 MINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQIPS 692 MINRDSWG SY +VRGEIL ++DEQ+RKH RMFSLIKNES G+EDDQIPS Sbjct: 1 MINRDSWGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 52 >ref|WP_016885142.1| MULTISPECIES: hypothetical protein [Bacteria] Length = 59 Score = 79.3 bits (194), Expect = 6e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +3 Query: 534 VMINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQIPS 692 VMINRDS G SY +VRGEIL ++DEQ+RKH RMFSLIKNES G+EDDQIPS Sbjct: 7 VMINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 59 >ref|WP_045623793.1| hypothetical protein [Vibrio vulnificus] gi|974706164|emb|CUW79419.1| conserved hypothetical protein [Escherichia coli] Length = 60 Score = 79.3 bits (194), Expect = 6e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +3 Query: 534 VMINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQIPS 692 VMINRDS G SY +VRGEIL ++DEQ+RKH RMFSLIKNES G+EDDQIPS Sbjct: 8 VMINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 60 >ref|WP_046876397.1| hypothetical protein, partial [Vibrio parahaemolyticus] gi|821242584|gb|KKZ05227.1| hypothetical protein YC68_24375, partial [Vibrio parahaemolyticus] Length = 66 Score = 79.3 bits (194), Expect = 7e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = +3 Query: 534 VMINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQIPS 692 VMINRDS G SY +VRGEIL ++DEQ+RKH RMFSLIKNES G+EDDQIPS Sbjct: 14 VMINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 66 >dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 82.8 bits (203), Expect = 1e-15 Identities = 46/86 (53%), Positives = 52/86 (60%) Frame = -3 Query: 773 VLSHMVPRESSM*HPWIPSRHSLWLRLRRYLIIFDPLTFVLD**KHPCRMLSHLFVFDGS 594 ++SH VP ES H IPSRHSLWLRL+RYLI+FDPLTF L V S Sbjct: 21 LISHKVPSESRKKHRPIPSRHSLWLRLQRYLIVFDPLTFKL--------------VLRKS 66 Query: 593 *NFTSHHRVRATPTVPINHYLGLRNQ 516 NFTS + PT+PINHY G RNQ Sbjct: 67 KNFTSDSAILMPPTIPINHYGGPRNQ 92 >ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|253759636|ref|XP_002488938.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|253759935|ref|XP_002488954.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|253759972|ref|XP_002488957.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|253760151|ref|XP_002488969.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|253760863|ref|XP_002489025.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|253761034|ref|XP_002489038.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|297836874|ref|XP_002886319.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|219887055|gb|ACL53902.1| unknown [Zea mays] gi|241946941|gb|EES20086.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|241947045|gb|EES20190.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|241947052|gb|EES20197.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|241947162|gb|EES20307.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|241947163|gb|EES20308.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|241947314|gb|EES20459.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|241947338|gb|EES20483.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|297332159|gb|EFH62578.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|902197674|gb|KNA13494.1| hypothetical protein SOVF_116400 [Spinacia oleracea] Length = 52 Score = 77.8 bits (190), Expect = 2e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = +3 Query: 537 MINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQIPS 692 MINRDS G SY +VRGEIL ++DEQ+RKH RMFSLIKNES G+EDDQIPS Sbjct: 1 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 52 >ref|XP_013946733.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] gi|358399225|gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 77.8 bits (190), Expect = 2e-15 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 262 PRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPM 164 PRFNYELFN N+FNIR WSWNYRGCWHQTCPP+ Sbjct: 24 PRFNYELFNHNNFNIRYWSWNYRGCWHQTCPPI 56 >ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] gi|928507157|ref|XP_014072420.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|477581303|gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 77.8 bits (190), Expect = 3e-15 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = -1 Query: 304 REAKTRKLFNRALPPRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPM 164 R A+ LF+ P FNYELFN N+FNIR WSWNYRGCWHQTCPP+ Sbjct: 19 RNARPILLFHANPDPSFNYELFNCNNFNIRYWSWNYRGCWHQTCPPI 65 >gb|KUJ06143.1| hypothetical protein LY89DRAFT_703091 [Phialocephala scopiformis] Length = 90 Score = 77.8 bits (190), Expect = 5e-15 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 283 LFNRALPPRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPM 164 LF+ PRFNYELFN N+FNIR WSWNYRGCWHQTCPP+ Sbjct: 48 LFHANPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCPPI 87 >gb|KNA06142.1| hypothetical protein SOVF_183600 [Spinacia oleracea] Length = 59 Score = 76.6 bits (187), Expect = 7e-15 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 262 PRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPM 164 PRFNYELFN N+FNIR WSWNYRGCWHQTCPP+ Sbjct: 24 PRFNYELFNCNNFNIRYWSWNYRGCWHQTCPPI 56 >gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] Length = 52 Score = 75.9 bits (185), Expect = 1e-14 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +3 Query: 537 MINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQIPS 692 MINRDS G SY +VRGEIL ++DEQ+RKH RMFSLIKNE G+EDDQIPS Sbjct: 1 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNERWGLEDDQIPS 52 >gb|KDQ32289.1| hypothetical protein PLEOSDRAFT_23300, partial [Pleurotus ostreatus PC15] Length = 74 Score = 75.1 bits (183), Expect = 4e-14 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 292 TRKLFNRALPPRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPM 164 +R NR +FNYELFN N+FNIR WSWNYRGCWHQTCPP+ Sbjct: 29 SRNQQNRTARLKFNYELFNCNNFNIRYWSWNYRGCWHQTCPPI 71 >ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] gi|328850152|gb|EGF99321.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 75.9 bits (185), Expect = 5e-14 Identities = 33/59 (55%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = -1 Query: 331 GRHTTSE--PPREAKTRKLFNRALPPRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPMD 161 G+H T++ P R+ + L +F+YELFN N+FNIR WSWNYRGCWHQTCPP+D Sbjct: 28 GKHPTNQYTPKRQTSHQTL-------KFDYELFNVNNFNIRYWSWNYRGCWHQTCPPID 79 >ref|XP_002488959.1| hypothetical protein SORBIDRAFT_1180s002020 [Sorghum bicolor] gi|241947001|gb|EES20146.1| hypothetical protein SORBIDRAFT_1180s002020 [Sorghum bicolor] Length = 69 Score = 73.6 bits (179), Expect = 1e-13 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +3 Query: 537 MINRDSWGRSYSVVRGEILRPIEDEQVRKHSTRMFSLIKNES*GIEDDQI 686 MINRDS G SY +VRGEIL ++DEQ+RKH RMFSLIKNES G+EDDQI Sbjct: 1 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQI 50 >gb|KRG68574.1| hypothetical protein GLYMA_U007300 [Glycine max] Length = 151 Score = 75.1 bits (183), Expect = 3e-13 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 262 PRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPMD 161 PR NYELFN N+ NIR WSWNYRGCWHQTCPPMD Sbjct: 116 PRSNYELFNCNNLNIRYWSWNYRGCWHQTCPPMD 149 >ref|XP_009534205.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] gi|695467858|ref|XP_009539727.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348665049|gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348671639|gb|EGZ11460.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] Length = 55 Score = 72.0 bits (175), Expect = 3e-13 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 253 NYELFNRNSFNIRCWSWNYRGCWHQTCPPMD 161 NYELFN N+FNIR WSWNYRGCWHQTCPP+D Sbjct: 23 NYELFNCNNFNIRYWSWNYRGCWHQTCPPID 53 >ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] gi|328852954|gb|EGG02096.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] Length = 71 Score = 72.4 bits (176), Expect = 3e-13 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 256 FNYELFNRNSFNIRCWSWNYRGCWHQTCPPMD 161 F+YELFN N+FNIR WSWNYRGCWHQTCPP+D Sbjct: 38 FDYELFNVNNFNIRYWSWNYRGCWHQTCPPID 69 >ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409072524|gb|EKM73697.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] Length = 73 Score = 72.4 bits (176), Expect = 4e-13 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 292 TRKLFNRALPPRFNYELFNRNSFNIRCWSWNYRGCWHQTCPPM 164 +R NR +FNY LFN N+FNIR WSWNYRGCWHQTCPP+ Sbjct: 28 SRNQQNRTARLKFNYGLFNCNNFNIRYWSWNYRGCWHQTCPPI 70