BLASTX nr result
ID: Rehmannia27_contig00038788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038788 (469 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKV71948.1| R2R3-MYB protein [Rehmannia glutinosa] 77 4e-14 ref|XP_012853037.1| PREDICTED: myb-related protein 306 [Erythran... 54 1e-05 >gb|AKV71948.1| R2R3-MYB protein [Rehmannia glutinosa] Length = 319 Score = 77.4 bits (189), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 3 PLSFLEKWLLDDAGVQGQDGYFMDMAASLGETADLF 110 PLSFLEKWLLDDAGVQGQDGYFMDMAASLGETADLF Sbjct: 284 PLSFLEKWLLDDAGVQGQDGYFMDMAASLGETADLF 319 >ref|XP_012853037.1| PREDICTED: myb-related protein 306 [Erythranthe guttata] gi|604305196|gb|EYU24375.1| hypothetical protein MIMGU_mgv1a009382mg [Erythranthe guttata] Length = 344 Score = 53.9 bits (128), Expect = 1e-05 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +3 Query: 3 PLSFLEKWLLDD-AGVQGQDGYFMDMAASLGETADLF 110 P S LEKWL DD A QGQDGYFM+MAA +GET+DLF Sbjct: 309 PFSLLEKWLFDDAAATQGQDGYFMEMAA-MGETSDLF 344