BLASTX nr result
ID: Rehmannia27_contig00038591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038591 (337 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090310.1| PREDICTED: cullin-1-like [Sesamum indicum] 59 6e-08 >ref|XP_011090310.1| PREDICTED: cullin-1-like [Sesamum indicum] Length = 278 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 VEECLQQEKNRVSDYLRLRSKHKVLQVVQHELLKVH 108 VEECL QEK RVSDYL+ RSK+ V+++VQHELL VH Sbjct: 228 VEECLNQEKGRVSDYLKFRSKYNVVEIVQHELLVVH 263