BLASTX nr result
ID: Rehmannia27_contig00034478
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00034478 (394 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074214.1| PREDICTED: pentatricopeptide repeat-containi... 62 9e-09 ref|XP_011073371.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-07 ref|XP_012856418.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-07 gb|EYU21693.1| hypothetical protein MIMGU_mgv1a024440mg, partial... 56 9e-07 >ref|XP_011074214.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Sesamum indicum] Length = 476 Score = 62.0 bits (149), Expect = 9e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 2 GLVDMARNYDDEMLLKGLSAKPRAELQAKMDDEGS 106 GLVDMAR YD+EMLLKGLSAKPRAELQ MD EGS Sbjct: 441 GLVDMARKYDEEMLLKGLSAKPRAELQTTMDTEGS 475 >ref|XP_011073371.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Sesamum indicum] gi|747054341|ref|XP_011073372.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Sesamum indicum] gi|747054343|ref|XP_011073374.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Sesamum indicum] Length = 478 Score = 56.6 bits (135), Expect = 7e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 2 GLVDMARNYDDEMLLKGLSAKPRAELQAKMDDEGSGD 112 GLVDMAR YD+EML+KGLSAKP+AELQ MD E S + Sbjct: 441 GLVDMARKYDEEMLMKGLSAKPKAELQTIMDSEVSSN 477 >ref|XP_012856418.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Erythranthe guttata] Length = 486 Score = 56.6 bits (135), Expect = 7e-07 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 2 GLVDMARNYDDEMLLKGLSAKPRAELQAKMDDEGSGDG*FSNLSSY 139 GLVD+AR YD+EML KG+SAKPRAELQ K DDE S N+ SY Sbjct: 440 GLVDIARRYDEEMLSKGISAKPRAELQKKTDDEVS-----QNVHSY 480 >gb|EYU21693.1| hypothetical protein MIMGU_mgv1a024440mg, partial [Erythranthe guttata] Length = 412 Score = 56.2 bits (134), Expect = 9e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 GLVDMARNYDDEMLLKGLSAKPRAELQAKMDDEGS 106 GLVD+AR YD+EML KG+SAKPRAELQ K DDE S Sbjct: 375 GLVDIARRYDEEMLSKGISAKPRAELQKKTDDEVS 409