BLASTX nr result
ID: Rehmannia27_contig00034461
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00034461 (447 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850253.1| PREDICTED: transmembrane emp24 domain-contai... 69 9e-12 ref|XP_011087766.1| PREDICTED: transmembrane emp24 domain-contai... 66 1e-10 ref|XP_012839767.1| PREDICTED: transmembrane emp24 domain-contai... 61 1e-08 >ref|XP_012850253.1| PREDICTED: transmembrane emp24 domain-containing protein p24delta3-like [Erythranthe guttata] gi|604313214|gb|EYU26545.1| hypothetical protein MIMGU_mgv1a013720mg [Erythranthe guttata] Length = 212 Score = 69.3 bits (168), Expect = 9e-12 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 260 MATGANVRAMLLLALMCVLQRSEAVWLSLPASGTKCVSEEIQ 385 M GANVR +LLL L+CV+QRS A+WLSLPA+GTKCVSEEIQ Sbjct: 1 MGVGANVRVVLLLFLLCVVQRSAAIWLSLPATGTKCVSEEIQ 42 >ref|XP_011087766.1| PREDICTED: transmembrane emp24 domain-containing protein p24delta3-like [Sesamum indicum] Length = 213 Score = 66.2 bits (160), Expect = 1e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +2 Query: 260 MATGANVRAMLLLALMCVLQRSEAVWLSLPASGTKCVSEEIQ 385 M GANV +LLL L+CVLQ +AVWLSLPASGTKCVSEEIQ Sbjct: 2 MGAGANVSDVLLLVLLCVLQGCQAVWLSLPASGTKCVSEEIQ 43 >ref|XP_012839767.1| PREDICTED: transmembrane emp24 domain-containing protein p24delta3-like [Erythranthe guttata] gi|604330407|gb|EYU35445.1| hypothetical protein MIMGU_mgv1a013634mg [Erythranthe guttata] Length = 214 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +2 Query: 260 MATGANVRAMLLLALMCVLQRSEAVWLSLPASGTKCVSEEI 382 M GA+V A LLL L+CV +RS+A+WL+LPA+GTKC+SEEI Sbjct: 1 MVVGAHVLAELLLVLLCVSRRSDAIWLNLPATGTKCISEEI 41